powered by:
Protein Alignment CG32354 and spink4
DIOPT Version :9
Sequence 1: | NP_729380.1 |
Gene: | CG32354 / 50302 |
FlyBaseID: | FBgn0052354 |
Length: | 662 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001314828.1 |
Gene: | spink4 / 100331208 |
ZFINID: | ZDB-GENE-130821-1 |
Length: | 76 |
Species: | Danio rerio |
Alignment Length: | 41 |
Identity: | 16/41 - (39%) |
Similarity: | 21/41 - (51%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 610 CPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYGAC 650
||....||||||..||.|:|.|.:|..:....:.:...|.|
Zfish 36 CPMNLAPVCGSDGNTYSNECLLCVERLKTKSDILIAKDGDC 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.