DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32354 and spink4

DIOPT Version :10

Sequence 1:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001314828.2 Gene:spink4 / 100331208 ZFINID:ZDB-GENE-130821-1 Length:76 Species:Danio rerio


Alignment Length:41 Identity:16/41 - (39%)
Similarity:21/41 - (51%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 CPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYGAC 650
            ||....||||||..||.|:|.|.:|..:....:.:...|.|
Zfish    36 CPMNLAPVCGSDGNTYSNECLLCVERLKTKSDILIAKDGDC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:412159
KAZAL 220..266 CDD:197624
KAZAL_FS 326..>359 CDD:412159
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:412159
KAZAL 606..650 CDD:197624 15/39 (38%)
spink4NP_001314828.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.