| Sequence 1: | NP_729380.1 | Gene: | CG32354 / 50302 | FlyBaseID: | FBgn0052354 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001121837.1 | Gene: | tmeff2a / 100004613 | ZFINID: | ZDB-GENE-070912-622 | Length: | 379 | Species: | Danio rerio |
| Alignment Length: | 238 | Identity: | 55/238 - (23%) |
|---|---|---|---|
| Similarity: | 84/238 - (35%) | Gaps: | 65/238 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 221 CKHRCSTEKDPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPCSNTSAVRESCPVDCNSAPK 285
Fly 286 DGPVCSSDGNVYN-----STCEMKLKTCGQGV---VKTSRKHCQSTRMCRESCWRVA-RPTCGSD 341
Fly 342 GRLYASPCKMRSSNCGKHV-FEVP-LSYC--------------------------MSQERHGASD 378
Fly 379 ACPTE----CPKSDTD---SSSQYVCGSDGNIYSSLCELKMLN 414 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32354 | NP_729380.1 | KAZAL_FS | 163..>200 | CDD:294071 | |
| KAZAL | 220..266 | CDD:197624 | 13/44 (30%) | ||
| KAZAL_FS | 326..>359 | CDD:294071 | 12/33 (36%) | ||
| KAZAL | 380..430 | CDD:197624 | 9/42 (21%) | ||
| KAZAL | 452..493 | CDD:197624 | |||
| KAZAL | 502..>536 | CDD:197624 | |||
| KAZAL_FS | 553..597 | CDD:294071 | |||
| KAZAL | 606..650 | CDD:197624 | |||
| tmeff2a | NP_001121837.1 | KAZAL_FS | 99..139 | CDD:238052 | 12/50 (24%) |
| KAZAL | 186..232 | CDD:197624 | 15/45 (33%) | ||
| PHA02887 | <266..306 | CDD:165214 | 6/39 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||