DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr21

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:215 Identity:124/215 - (57%)
Similarity:165/215 - (76%) Gaps:6/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDT 137
            ||||.|..:|||:|:|.:.:|:||::||.|||||||||||:|:|||...||||||||.:.:::.|
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   138 EDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKF 202
            .||:||||:.|.||:|:||||:||.|...|.:..:||.|..:|||||::::|.|||:||||.:|.
  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180

  Fly   203 SPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASV 267
            .|:||..:.|.|:.:.|||||.||||||||||||:|||:||||.|.:||||:|:|.||||:..||
  Fly   181 LPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSV 245

  Fly   268 RVHVLNVRAIISGEHPEAMQ 287
            .||:|      .|:||.|:|
  Fly   246 NVHIL------KGDHPAAVQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 6/16 (38%)
IG_like 80..175 CDD:214653 53/94 (56%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 3/6 (50%)
FR2 105..114 CDD:409355 8/8 (100%)
Ig strand C 105..110 CDD:409355 4/4 (100%)
CDR2 115..129 CDD:409355 9/13 (69%)
Ig strand D 129..135 CDD:409355 1/5 (20%)
FR3 130..159 CDD:409355 14/28 (50%)
Ig strand E 139..145 CDD:409355 4/5 (80%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 53/86 (62%)
Ig strand B 194..198 CDD:409353 2/3 (67%)
Ig strand C 209..213 CDD:409353 0/3 (0%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)
dpr21NP_001163838.2 Ig 71..149 CDD:472250 47/77 (61%)
Ig strand C 82..86 CDD:409353 3/3 (100%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 3/4 (75%)
Ig 169..249 CDD:472250 51/79 (65%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.