DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr21

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:215 Identity:124/215 - (57%)
Similarity:165/215 - (76%) Gaps:6/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDT 137
            ||||.|..:|||:|:|.:.:|:||::||.|||||||||||:|:|||...||||||||.:.:::.|
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   138 EDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKF 202
            .||:||||:.|.||:|:||||:||.|...|.:..:||.|..:|||||::::|.|||:||||.:|.
  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180

  Fly   203 SPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASV 267
            .|:||..:.|.|:.:.|||||.||||||||||||:|||:||||.|.:||||:|:|.||||:..||
  Fly   181 LPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSV 245

  Fly   268 RVHVLNVRAIISGEHPEAMQ 287
            .||:|      .|:||.|:|
  Fly   246 NVHIL------KGDHPAAVQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 52/94 (55%)
IG_like 80..175 CDD:214653 53/94 (56%)
IG_like 184..271 CDD:214653 53/86 (62%)
IGc2 191..262 CDD:197706 46/70 (66%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 47/77 (61%)
IG_like 71..140 CDD:214653 44/68 (65%)
IG_like 162..249 CDD:214653 53/86 (62%)
IGc2 169..242 CDD:197706 48/72 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446146
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D77526at33392
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
88.000

Return to query results.
Submit another query.