DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and CADM3

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:413 Identity:86/413 - (20%)
Similarity:138/413 - (33%) Gaps:104/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AWLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAA----------LLLPTAPTAAYT 66
            |.||||:::.......||.....:||....||...|..|...|          :|....|...:.
Human     6 ASLLLLLLLFACCWAPGGANLSQDGYWQEQDLELGTLAPLDEAISSTVWSSPDMLASQGPLLCWE 70

  Fly    67 HP-----KWMEP---------------------------YFDPSTP--RNVTALMGKSAYLSCRV 97
            ||     ||...                           .|..|.|  .:.|.:.|.:..|.|:|
Human    71 HPLAISWKWNSSNQERNKQTGRGKVVAGRPNVEQQICLCVFRDSQPWTSDETVVAGGTVVLKCQV 135

  Fly    98 RNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQ---ATHHQDTEDWTLQIKWAQKRDAGMYECQI 159
            ::..:.::.|..... ..|..|......|.|.|   :|.|    :.::.|......|.|.|.|.|
Human   136 KDHEDSSLQWSNPAQ-QTLYFGEKRALRDNRIQLVTSTPH----ELSISISNVALADEGEYTCSI 195

  Fly   160 STQPVRSYFVRLNVV-VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDS 223
            .|.|||:....:.|: :|...|:.|....:.:..|..|.|....| :|.|.:.|...::.::.:.
Human   196 FTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGS-KPAARLTWRKGDQELHGEP 259

  Fly   224 SRGGVSVITE----KGDVTTSFLLIQNADLADSGKYSCAPSNADV------ASVRVHVL-NVRAI 277
            :|     |.|    |....:|.:..|.....|.....|:.::..:      .|.|:.|| ...|:
Human   260 TR-----IQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAM 319

  Fly   278 ISGE--HPEAMQTGSSGC---------QYNW--------LTIVLLLGLVLCYSSQQCSSAVPASL 323
            |..:  ||...|.....|         ||.|        |.:.....|:..:.::..|.....:.
Human   320 IRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTA 384

  Fly   324 TSSL---------------PLPS 331
            ||::               |:||
Human   385 TSNMGSYKAYYTLNVNDPSPVPS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/99 (24%)
IG_like 80..175 CDD:214653 25/100 (25%)
IG_like 184..271 CDD:214653 17/96 (18%)
IGc2 191..262 CDD:197706 15/74 (20%)
CADM3XP_024304528.1 Ig1_Necl-1 115..209 CDD:143290 24/98 (24%)
Ig2_Necl-1 230..312 CDD:143329 17/87 (20%)
IG_like 328..399 CDD:214653 10/70 (14%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.