DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dscama

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:298 Identity:76/298 - (25%)
Similarity:114/298 - (38%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HPLPLCVAWLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPK 69
            ||.|. ..||          ..|..::.......|:..||.....|         :.|.:|....
Zfish   252 HPAPK-YRWL----------KNNRPLESDSRFRQSVTGLLIERAQP---------SDTGSYVCEV 296

  Fly    70 W--------------MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGS 120
            |              .||.....:||.|...:|....|||.|.......:||.|:.|  .:..| 
Zfish   297 WNSYGNAEVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGD--KINTG- 358

  Fly   121 YTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYEC-----QISTQPVRSYFVRLNVVVPTATI 180
                ::.|....:.::     |.:....|.|.|:|:|     ::|.|.    ||::.:...|..|
Zfish   359 ----ANIRMNGINKEN-----LVMDGMAKSDGGVYQCFSRKAKMSAQD----FVQVILEDGTPKI 410

  Fly   181 LG-------GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVT 238
            |.       ||:      ..::|||.||.:|:|.  |.|...:||:..||....|..||.:|:| 
Zfish   411 LSAFSEKVVGPN------DFVSLTCHVKGTPQPA--ITWTLDDEVVAKDSRHRIVHSITAEGNV- 466

  Fly   239 TSFLLIQNADLADSGKYSCAPSN-ADVASVRVHVLNVR 275
            .|:|.|.:..:.|||.|.|..:| |...|.:..: |||
Zfish   467 VSYLNISHIQVRDSGVYRCTCNNSAGTVSYQARI-NVR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/99 (24%)
IG_like 80..175 CDD:214653 24/99 (24%)
IG_like 184..271 CDD:214653 30/87 (34%)
IGc2 191..262 CDD:197706 27/71 (38%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352 13/78 (17%)
IG_like 321..402 CDD:214653 24/96 (25%)
I-set 408..502 CDD:333254 33/103 (32%)
IGc2 524..579 CDD:197706
Ig 614..679 CDD:319273
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.