DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:291 Identity:62/291 - (21%)
Similarity:100/291 - (34%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IAHPL-----PLCVAWLLLLVVIVM----------SDMTNGGVQGPIEGYNSLDDLLTTTPTPG- 51
            ::|||     |..|.|....|.|..          .|....| :..:.|..||......:...| 
Zfish    47 VSHPLNGQQTPYVVEWFKFGVPIPFFINFRFYPPHVDPEYAG-RASLHGKASLQIEQVRSEDQGW 110

  Fly    52 -QAALLLPTAPTAAYTHPKWME------PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIR 109
             :..:|:.......:.:..|:.      |.|..:.|:.|.|..|.|..|:|.........|:|:|
Zfish   111 YECRVLMLEQQYDTFHNGSWVHLTVNAPPTFSDTPPQYVEAREGGSITLTCTAFGNPKPVVTWLR 175

  Fly   110 HRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQI-STQPVRSYFVRLNV 173
            ..|               :..:|......|.:|.::...:.|.|.|.|:. |.|....:..||.|
Zfish   176 EGD---------------QLTSTRKYTVSDGSLTVQAITREDRGAYSCRAHSDQGEALHTTRLLV 225

  Fly   174 VVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDV- 237
            ..|...:....::.|:.......||..:..|....|. ||..|:.:.:            |.|: 
Zfish   226 QGPPYIVTPPENITVNISQNAQFTCQAEAYPGNLTYT-WYWEEDNVYF------------KNDLK 277

  Fly   238 ------TTSFLLIQNADLADSGKYSCAPSNA 262
                  ....|:|......|:|||:|:|||:
Zfish   278 LRVRIFIDGTLIIYRVKPEDAGKYTCSPSNS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 22/95 (23%)
IG_like 80..175 CDD:214653 23/95 (24%)
IG_like 184..271 CDD:214653 20/86 (23%)
IGc2 191..262 CDD:197706 18/77 (23%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 14/68 (21%)
I-set 139..225 CDD:254352 24/100 (24%)
I-set 229..321 CDD:333254 20/93 (22%)
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.