DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and robo4

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:375 Identity:79/375 - (21%)
Similarity:111/375 - (29%) Gaps:147/375 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRNVTALMGKSAYLSCRVRNLANKTVSWIRH--------RDIH----ILTVGSYTYTS------D 126
            |.:|...:|..|.||||.......|:.|:|:        .|..    :|..||..:.|      .
Zfish    77 PSDVVVRVGSPATLSCRAEGNPEPTIQWLRNGQPLDTDKMDAQSQPIVLPDGSLFFFSVVPGRKG 141

  Fly   127 QRFQATH----HQD----------------TEDWTLQ--------------------------IK 145
            |..:|.:    |..                .||:.:|                          :.
Zfish   142 QSHEAVYACIAHNSIGNATSRNASLHIAALREDFRVQPSDVEVAIGEMATINCSPPVGHPEPNVT 206

  Fly   146 W-------------------------AQKRDAGMYECQISTQ-PVR-SYFVRLNVVVPTATILGG 183
            |                         |||.|:|:|.|..|.. .|| |...||:|:.....:...
Zfish   207 WRKDGILINSSNEHYTELKGKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVLLRKP 271

  Fly   184 PDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHE-------EVINYDSSRGGVSVITEKGDVTTSF 241
            .|:.|..|.:....|.....|.|.  |.|...:       .:||.|.|                 
Zfish   272 EDVSVQLGESAQFFCEADGDPMPS--IEWSREQGPLPNGRYLINPDHS----------------- 317

  Fly   242 LLIQNADLADSGKYSCAPSN---ADVASVRVHV-----LNVRAI--------ISGEHPEAMQTGS 290
            |.|......|.|:|||...|   ..|||.::.|     ..:|.:        :|.|:...|.|.|
Zfish   318 LQIHYVTAQDMGRYSCTVENKLGVSVASAQLLVEDAGGTRLRDLHKELSALRVSLENVTVMSTAS 382

  Fly   291 SGCQYNWLTIVL------LLGLVLCYSSQQCSSAVPAS---LTSSLPLPS 331
            :..|..|.....      |.|..:.|     .|.:|||   ....:|.||
Zfish   383 NMSQVMWKLQSFGSQPHYLEGFEVLY-----RSLLPASSDWTAQRVPQPS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 36/184 (20%)
IG_like 80..175 CDD:214653 37/185 (20%)
IG_like 184..271 CDD:214653 23/96 (24%)
IGc2 191..262 CDD:197706 18/80 (23%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 19/91 (21%)
I-set 71..168 CDD:254352 19/90 (21%)
I-set 175..261 CDD:254352 15/85 (18%)
Ig2_Robo 177..261 CDD:143201 15/83 (18%)
I-set 265..350 CDD:254352 23/103 (22%)
Ig 282..350 CDD:299845 20/86 (23%)
FN3 373..448 CDD:214495 16/60 (27%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.