DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and lrit3a

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:239 Identity:47/239 - (19%)
Similarity:74/239 - (30%) Gaps:70/239 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LTTTPTPGQAALL----LPTAPTAAYTHPKWMEPYFDP---------STPRNVTALMGKSAYLSC 95
            ||:.|......|:    |..:.....|.|..:...:.|         ::.:.|..|.....|..|
Zfish   141 LTSVPVEAAPYLINITYLDISSNKLTTLPSDLVDIWPPFSGIQPSANTSQKTVLGLQDNPWYCDC 205

  Fly    96 RVRNLANKTVSWIRHRDI------HILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGM 154
            |:    :|.:...:...|      .:||.....:.|...||.                    |.:
Zfish   206 RI----SKLIELSKMAGIPVVLMDQVLTCSGPEHLSGVLFQR--------------------AEL 246

  Fly   155 YECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVI 219
            .:|...|            |:.:||.:..|     .||.:.|.|.....|.|.  :.|      .
Zfish   247 DQCVKPT------------VMTSATKITSP-----LGSNVLLRCDANGFPTPT--LLW------T 286

  Fly   220 NYDSSRGGVSVITEK-GD-VTTSFLLIQNADLADSGKYSCAPSN 261
            ..|.|....:|:.|. |: |..|.|.:.:....|:|.|.|...|
Zfish   287 TADGSVVNNTVVQESPGEGVRWSILSLHSIVFKDAGDYRCKAKN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 15/100 (15%)
IG_like 80..175 CDD:214653 15/100 (15%)
IG_like 184..271 CDD:214653 21/80 (26%)
IGc2 191..262 CDD:197706 20/73 (27%)
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566 47/239 (20%)
leucine-rich repeat 83..106 CDD:275378
LRR_4 107..145 CDD:289563 2/3 (67%)
leucine-rich repeat 107..130 CDD:275378
LRR_8 129..>171 CDD:290566 7/29 (24%)
LRR_4 129..170 CDD:289563 6/28 (21%)
leucine-rich repeat 131..154 CDD:275378 4/12 (33%)
leucine-rich repeat 155..168 CDD:275378 1/12 (8%)
TPKR_C2 199..249 CDD:301599 11/73 (15%)
Ig 252..343 CDD:299845 25/104 (24%)
IG_like 261..343 CDD:214653 21/83 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.