DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and igsf9b

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:463 Identity:87/463 - (18%)
Similarity:138/463 - (29%) Gaps:173/463 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WLLLLVVIVMSDM------TNGGVQGPIEGYNSLDDLLT------TTPTPGQAALLLP------- 58
            |||.:.|.|...:      |...|||.:.|:..|...||      |||.      |.|       
Zfish     7 WLLNVSVAVALSLLRLTLSTEPVVQGRVGGFAELGCSLTPPSEGATTPN------LFPLHVVEWV 65

  Fly    59 ----TAPT----AAYT---HPK------------------------WME---------------- 72
                ..|.    .:||   ||.                        |.|                
Zfish    66 RLGYNVPILIKFGSYTPRVHPNYKGRVSLSRGASLMVEKLTLEDEGWFECRILLLDRTSDEFQNG 130

  Fly    73 ----------PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRH-------RDIHILTVGS 120
                      |.|..:.|..:..|:|:|..|.|........|:.|.::       .:|.:|    
Zfish   131 TWNFLSITAPPVFIKTPPPFLEVLLGESLTLHCDAHGNPKPTIIWRKYLSAAEKQEEIQVL---- 191

  Fly   121 YTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQIS-TQPVRSYFVRLNVVVPTATILGGP 184
                              :.||.:....:..||:|:|.:| ::...::..:|.|..|...|:...
Zfish   192 ------------------NETLSLSKVTRETAGIYKCHVSNSEGNLTHSTQLQVKGPPIIIIAPE 238

  Fly   185 DLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADL 249
            |..::......|.|..:..|....|.:|...:.|.:.:..:..|.::.: |.:..|.|:..    
Zfish   239 DTTMNMSQDAVLQCQAEAYPSNLTYEWWKQGQNVYHIEILKSRVKILVD-GTLLISALIPD---- 298

  Fly   250 ADSGKYSCAPSNA----DVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCY 310
             |||.|:|.|:|.    ..||         |.::.:||..:                        
Zfish   299 -DSGNYTCRPTNGLMTPPAAS---------AYLTVKHPARV------------------------ 329

  Fly   311 SSQQCSSAVPASLTSSLPLPSQLPLPAAAAATTTATGESASSES-------------VTAARASA 362
            ......:.:|..:...:|.|.|.. |.......|..|.|.:.|.             :|||...|
Zfish   330 VRMPRETYLPMGMGGKIPCPVQAE-PPMLYVNWTKDGASLNLEQYPGWMVNSEGSVFITAANDDA 393

  Fly   363 ATTTTTTA 370
            ....|.||
Zfish   394 VGMYTCTA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 18/102 (18%)
IG_like 80..175 CDD:214653 19/102 (19%)
IG_like 184..271 CDD:214653 20/90 (22%)
IGc2 191..262 CDD:197706 16/70 (23%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845 19/110 (17%)
IG_like 148..227 CDD:214653 18/100 (18%)
IGc2 156..217 CDD:197706 15/82 (18%)
Ig 237..323 CDD:299845 21/100 (21%)
IG_like 237..323 CDD:214653 21/100 (21%)
Ig 345..411 CDD:143165 15/58 (26%)
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.