DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Ntm

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:297 Identity:83/297 - (27%)
Similarity:122/297 - (41%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNSLDDLLTTTPTPGQAALLL----PTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRV 97
            :||:...:.|    |.|||.|    |.....| |.||.|:         |||...|:||.|.|.:
  Rat     9 HNSISWAIFT----GLAALCLFQGVPVRSGDA-TFPKAMD---------NVTVRQGESATLRCTI 59

  Fly    98 RNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQIST- 161
            .|...: |:|:....  ||..|:..:..|.|.....:..|: ::::|:.....|.|.|.|.:.| 
  Rat    60 DNRVTR-VAWLNRST--ILYAGNDKWCLDPRVVLLSNTQTQ-YSIEIQNVDVYDEGPYTCSVQTD 120

  Fly   162 -QPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSR 225
             .|..|. |.|.|.|....:....|:.:::|:.|:|||.....|||.  :.|.|        .|.
  Rat   121 NHPKTSR-VHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPT--VTWRH--------ISP 174

  Fly   226 GGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASV---RVHV-LNVRAIISGEHPEAM 286
            ..|..::|     ..:|.||......||:|.|:.|| |||:.   ||.| :|....||......:
  Rat   175 KAVGFVSE-----DEYLEIQGITREQSGEYECSASN-DVAAPVVRRVKVTVNYPPYISEAKGTGV 233

  Fly   287 QTGSSGCQYNWLTIVLLLGLVLCYSSQQC-SSAVPAS 322
            ..|..|                   :.|| :||||::
  Rat   234 PVGQKG-------------------TLQCEASAVPSA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 7/16 (44%)
IG_like 80..175 CDD:214653 28/96 (29%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 4/7 (57%)
CDR1 97..104 CDD:409355 1/6 (17%)
FR2 105..114 CDD:409355 2/8 (25%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 4/13 (31%)
Ig strand D 129..135 CDD:409355 0/5 (0%)
FR3 130..159 CDD:409355 6/28 (21%)
Ig strand E 139..145 CDD:409355 0/5 (0%)
Ig strand F 153..160 CDD:409355 3/6 (50%)
IG_like 184..271 CDD:214653 28/89 (31%)
Ig strand B 194..198 CDD:409353 2/3 (67%)
Ig strand C 209..213 CDD:409353 0/3 (0%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 2/2 (100%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 27/92 (29%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 1/4 (25%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 1/3 (33%)
Ig_3 136..205 CDD:464046 21/83 (25%)
Ig 223..307 CDD:472250 10/48 (21%)
Ig strand B 239..243 CDD:409408 1/22 (5%)
Ig strand C 252..256 CDD:409408 83/297 (28%)
Ig strand E 278..282 CDD:409408
Ig strand F 292..297 CDD:409408
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.