DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr12

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:290 Identity:110/290 - (37%)
Similarity:157/290 - (54%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LPLCVAWLLLLV--------VIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTA 63
            |.||:..|||..        ::..:|.....::|.|.|.:.||:.|.::.:              
  Fly    24 LLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDS-------------- 74

  Fly    64 AYTHPKWMEPYFDPS--TPRNVTALMGKSAYLSCRVRNLAN-----KTVSWIRHRDIHILTVGSY 121
                     |.|:.|  ...|.|..:|.:|:|.|:|..:..     ..:||||.||.|||:.|:.
  Fly    75 ---------PMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQ 130

  Fly   122 TYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQP-VRSYFVRLNVVVPTATILGGPD 185
            .||:|:||...|...:..||||||:.|:||.||||||:||.. :.|:||.|.||||.|.|||..:
  Fly   131 LYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGE 195

  Fly   186 LHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLA 250
            ||||.||||||.|.::.||.||.|::|..::.:|||..||..:::.|..|..|.|.|:|:...:.
  Fly   196 LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVT 260

  Fly   251 DSGKYSCAPSNADVASVRVHVL---NVRAI 277
            |||.|:|:.||.:.||:.|.|.   |:.||
  Fly   261 DSGNYTCSASNTEPASIYVFVSKGDNMAAI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 44/100 (44%)
IG_like 80..175 CDD:214653 45/100 (45%)
IG_like 184..271 CDD:214653 38/86 (44%)
IGc2 191..262 CDD:197706 30/70 (43%)
dpr12NP_652462.3 IG 86..183 CDD:214652 44/96 (46%)
Ig_3 193..271 CDD:404760 33/77 (43%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.