DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and NCAM2

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:181 Identity:47/181 - (25%)
Similarity:73/181 - (40%) Gaps:31/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDA 152
            |:.|.:.|||.:.....|||:.|.:       ..|..||.||....:.:     |||....|.|.
Human   154 GEDAEVVCRVSSSPAPAVSWLYHNE-------EVTTISDNRFAMLANNN-----LQILNINKSDE 206

  Fly   153 GMYECQISTQ-----PVRSYFVRLNVVVPTATILGGPDLH--VDKGSTINLTCTVKFSPEPPAYI 210
            |:|.|:...:     ..|...|.:|  ||.|..:.....:  .::|..:..:|....||||.  |
Human   207 GIYRCEGRVEAR
GEIDFRDIIVIVN--VPPAISMPQKSFNATAERGEEMTFSCRASGSPEPA--I 267

  Fly   211 FWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN 261
            .|:.:.::|..:..      ...||..|.  |.::|...:|.|.|.|..:|
Human   268 SWFRNGKLIEENEK------YILKGSNTE--LTVRNIINSDGGPYVCRATN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 2/7 (29%)
IG_like 80..175 CDD:214653 25/91 (27%)
Ig strand A' 83..85 CDD:409355
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 1/6 (17%)
FR2 105..114 CDD:409355 4/8 (50%)
Ig strand C 105..110 CDD:409355 3/4 (75%)
CDR2 115..129 CDD:409355 3/13 (23%)
Ig strand D 129..135 CDD:409355 1/5 (20%)
FR3 130..159 CDD:409355 8/28 (29%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 3/6 (50%)
IG_like 184..271 CDD:214653 19/80 (24%)
Ig strand B 194..198 CDD:409353 0/3 (0%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452
Ig strand C 74..80 CDD:409452
Ig strand C' 83..85 CDD:409452
Ig strand D 91..97 CDD:409452
Ig strand E 99..107 CDD:409452
Ig strand F 114..121 CDD:409452
Ig strand G 126..137 CDD:409452
Ig 142..218 CDD:472250 22/75 (29%)
Ig strand C 170..174 CDD:409353 2/3 (67%)
Ig strand E 193..197 CDD:409353 0/8 (0%)
IgI_1_MuSK 234..323 CDD:409562 20/87 (23%)
Ig strand A 234..237 CDD:409562 1/2 (50%)
Ig strand A' 242..247 CDD:409562 0/4 (0%)
Ig strand B 253..260 CDD:409562 1/6 (17%)
Ig strand C 266..271 CDD:409562 2/6 (33%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 0/2 (0%)
Ig strand E 289..295 CDD:409562 2/7 (29%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562
IgI_NCAM-2 325..422 CDD:143278
Ig strand A 325..330 CDD:143278
Ig strand A' 334..338 CDD:143278
Ig strand B 342..350 CDD:143278
Ig strand C 356..362 CDD:143278
Ig strand C' 365..368 CDD:143278
Ig strand D 378..384 CDD:143278
Ig strand E 387..393 CDD:143278
Ig strand F 401..409 CDD:143278
Ig strand G 412..422 CDD:143278
Ig_3 426..504 CDD:464046
FN3 521..613 CDD:238020
fn3 619..703 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.