DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and NCAM1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:350 Identity:72/350 - (20%)
Similarity:116/350 - (33%) Gaps:106/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GKSAYLSCRVRNLANKTVSWIRH--RDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKR 150
            |:.|.:.|.|.:....|:.| :|  ||:.:        ..|.||....:.     .|||:..:|.
Human   132 GEDAVIVCDVVSSLPPTIIW-KHKGRDVIL--------KKDVRFIVLSNN-----YLQIRGIKKT 182

  Fly   151 DAGMYECQ-----------------ISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTC 198
            |.|.|.|:                 ::..|  :...|.|:|..||.:          |.::.|.|
Human   183 DEGTYRCE
GRILARGEINFKDIQVIVNVPP--TIQARQNIVNATANL----------GQSVTLVC 235

  Fly   199 TVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDV------TTSFLLIQNADLADSGKYSC 257
            ..:..|||.  :.|           ::.|..:..|:.|.      .:|.|.|:..|..|..:|.|
Human   236 DAEGFPEPT--MSW-----------TKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYIC 287

  Fly   258 APSN---ADVASVRVHVLNVRAIISGEHPEAMQ-----------TGSSGCQYNWLTIVLLLGLVL 308
            ...|   ...|::.:.|.....|...|:..||:           :|.......|.|         
Human   288 IAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRT--------- 343

  Fly   309 CYSSQQCSSAVPASLTSSLPLPSQLPLP----------AAAAATTTATGESASSESVTAARASAA 363
              |::..||...||.|.  |...::..|          .|.:|....:.|:.....|..:.|..:
Human   344 --STRNISSEEKASWTR--PEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVS 404

  Fly   364 TTTT-----TTATRKRCPAVKSCRQ 383
            :.|.     |.|....|.|..:..|
Human   405 SLTLKSIQYTDAGEYICTASNTIGQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 23/104 (22%)
IG_like 80..175 CDD:214653 23/105 (22%)
IG_like 184..271 CDD:214653 19/95 (20%)
IGc2 191..262 CDD:197706 18/79 (23%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 19/71 (27%)
Ig 211..307 CDD:325142 26/120 (22%)
Ig 306..438 CDD:325142 25/136 (18%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.