DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and tutl

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:433 Identity:82/433 - (18%)
Similarity:131/433 - (30%) Gaps:173/433 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DLLTTTPTPGQAALLLPTAPTAAYT---------------------------------------- 66
            |..|||..|....|....|.|||:|                                        
  Fly    50 DRTTTTTIPASKTLTASPAKTAAFTVKTTRRRRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFV 114

  Fly    67 -------HPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVG----- 119
                   ..|..:.:..|....::||::|:....:|.|....:..|.::...|..:...|     
  Fly   115 LVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPI 179

  Fly   120 -----SYTYTSDQRFQATHHQDTED-----WTLQIKWAQKRDAGMYECQI------STQPVRSYF 168
                 ||....::.::....:.::|     .:|.:...::.|.|.|||::      ..|.....:
  Fly   180 YIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTW 244

  Fly   169 VRLNVVVPTATILGGPD-LHVDKGSTINLTCTVKFSPEPPAYIFWY------------------- 213
            ..|:|..|....:...| ::|:.|.:|.|.|....:|.|.  |.||                   
  Fly   245 FHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPE--ILWYKDANPVDPSPTVGIFNDGT 307

  Fly   214 -------HHEEVINY------------DSSR----GGVSVIT----------EK----------- 234
                   .||::..|            .::|    ||..::.          ||           
  Fly   308 ELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMP 372

  Fly   235 GDVTTSF------------------------LLIQNADLADSGKYSCAPSN--ADVASVRVHVLN 273
            |:||..:                        |:|......|||:|.|..:|  .|..|       
  Fly   373 GNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQS------- 430

  Fly   274 VRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCY--SSQQ 314
            ..|.:|.|:| |..|.:...||   ....|.|:|.||  ||.|
  Fly   431 ASAYLSVEYP-AKVTFTPTVQY---LPFRLAGVVQCYIKSSPQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 19/115 (17%)
IG_like 80..175 CDD:214653 20/115 (17%)
IG_like 184..271 CDD:214653 32/176 (18%)
IGc2 191..262 CDD:197706 28/159 (18%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 19/112 (17%)
IG_like 137..229 CDD:214653 17/91 (19%)
I-set 253..341 CDD:254352 15/89 (17%)
IGc2 268..331 CDD:197706 12/64 (19%)
I-set 346..437 CDD:254352 16/97 (16%)
Ig 349..437 CDD:299845 16/94 (17%)
Ig 459..530 CDD:299845 6/11 (55%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.