DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and opcml

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:244 Identity:71/244 - (29%)
Similarity:106/244 - (43%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKW 146
            |:|...|.||.|.|.:.|..:: |:|:....  ||..|:..::.|.|. ...:....:::::|..
Zfish    41 NITVRQGDSAVLKCSMDNKVSR-VAWLNRTT--ILFTGNEKWSLDPRV-VLLNTAVNEYSIKILN 101

  Fly   147 AQKRDAGMYECQIST-QPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYI 210
            ....|.|.|.|.|.| :...|..|.|.|.||...:....|:.|::||.::|.|.....|||.  |
Zfish   102 VNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEPS--I 164

  Fly   211 FWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN----ADVASVRVHV 271
            .|       .:.||:|. .::||...|..:.:   ..|:  ||.|.|..||    .||.:|:|.|
Zfish   165 LW-------KFRSSKGN-RIVTEGEYVEMTGI---TKDM--SGSYDCITSNDISPPDVRTVQVTV 216

  Fly   272 LNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVP 320
             |...:||    .|..||         |.|...|::.|.     :||||
Zfish   217 -NYPPVIS----RARSTG---------TAVGQKGVLWCE-----ASAVP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 25/92 (27%)
IG_like 80..175 CDD:214653 26/93 (28%)
IG_like 184..271 CDD:214653 28/90 (31%)
IGc2 191..262 CDD:197706 22/74 (30%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 25/91 (27%)
IG_like 41..129 CDD:214653 25/91 (27%)
IG_like 139..216 CDD:214653 28/91 (31%)
IGc2 146..202 CDD:197706 20/70 (29%)
I-set 219..307 CDD:254352 13/46 (28%)
ig 223..307 CDD:278476 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.