DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:115/278 - (41%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKW 146
            |||...|:.|.|:|.||||....|.|:|..|..:|.:.....|.:.|. :..|||...|.|:|..
  Fly    47 NVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARI-SVMHQDMHTWKLKISK 110

  Fly   147 AQKRDAGMYECQISTQPVRSYFVRLNVVVPTATI--LGGPDLHVDKGSTINLTCTVKFSPEPPAY 209
            .::.|.|.|.|||:|.|::.....::|.||...|  ....||.|.:|....|||....:|:|  .
  Fly   111 LRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP--R 173

  Fly   210 IFWYHHEE---VINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHV 271
            :.|...:.   :|....||..:.|.:..|    |.|.:...:....|.|.|..|| ||..    .
  Fly   174 VTWRREDGEMILIRKPGSRELMKVESYNG----SSLRLLRLERRQMGAYLCIASN-DVPP----A 229

  Fly   272 LNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSLPLPSQLPLP 336
            ::.|..:|.:....::..|.           |||..| .|..|....|.||     |.|....|.
  Fly   230 VSKRVSLSVQFAPMVRAPSQ-----------LLGTPL-GSDVQLECQVEAS-----PSPVSYWLK 277

  Fly   337 AAAAATTTATGESASSES 354
            .|..:...|:..:||.||
  Fly   278 GARTSNGFASVSTASLES 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 32/91 (35%)
IG_like 80..175 CDD:214653 33/92 (36%)
IG_like 184..271 CDD:214653 24/89 (27%)
IGc2 191..262 CDD:197706 18/73 (25%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 33/92 (36%)
Ig 47..129 CDD:299845 32/82 (39%)
Ig 140..238 CDD:299845 27/108 (25%)
IG_like 247..355 CDD:214653 19/66 (29%)
Ig 256..351 CDD:299845 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.