DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Dscam3

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:361 Identity:75/361 - (20%)
Similarity:127/361 - (35%) Gaps:72/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIR-----HRD 112
            ||.:..||.......|:|.      ..|.:...::|.:..::|........|::|.:     .:|
  Fly   713 AAKVNYTAELQVRVAPRWR------YEPMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKD 771

  Fly   113 IHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYF---VRLNVV 174
            ...|::.::                   :|.:..|...|.|.|.|| :|..:.:..   :|:||.
  Fly   772 FKPLSMRNH-------------------SLLLNLATDNDEGYYMCQ-ATNEIGAGLKKTIRINVN 816

  Fly   175 VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVI-TEKGDVT 238
            .|........::...:...:.|.|..|  .:.|..|.|..:...|:.::.|..::.: ||||  .
  Fly   817 EPARFEQSARNISSRRNDPVTLDCHAK--GDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKG--V 877

  Fly   239 TSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHP------EAMQTGSSGCQYNW 297
            .|.|.|.::|..|||.|.|...|....:.::..|.|:     |.|      |..:.||...:.:|
  Fly   878 DSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQ-----ERPDTPSHLEIFEVGSRTVKLSW 937

  Fly   298 ---------LTIVLLLGLVLCYSSQQCSSAVPAS------LTSSLP-------LPSQLPLPAAAA 340
                     :...|:....|.|.....|.|....      :..|||       ..|.|...|..|
  Fly   938 RRPFDGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVA 1002

  Fly   341 ATTTATGESASSESVTAARASAATTTTTTATRKRCP 376
            ..|.||......:::.....||.|......|::..|
  Fly  1003 GLTPATTFLIRMQAINEIERSAYTEAIVLKTQEEAP 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 17/102 (17%)
IG_like 80..175 CDD:214653 18/102 (18%)
IG_like 184..271 CDD:214653 22/87 (25%)
IGc2 191..262 CDD:197706 21/71 (30%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 4/10 (40%)
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653 16/100 (16%)
Ig 745..815 CDD:299845 14/89 (16%)
I-set 820..913 CDD:254352 23/96 (24%)
Ig 838..920 CDD:299845 26/90 (29%)
FN3 917..1033 CDD:238020 23/115 (20%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.