DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr17

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:244 Identity:89/244 - (36%)
Similarity:136/244 - (55%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTE-DWTLQIK 145
            |:||.||..||:.|::..|::|.|||:|.||.||::|...|:.:|:|||:.:.:|.: .|:||||
  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478

  Fly   146 WAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYI 210
            :.:..|||.||||::|:|..|..|.|.:|.|...::|.....|..||.:.|.|.|:.:.:||.||
  Fly   479 YVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYI 543

  Fly   211 FWYHHEEVINYDSSRGG------VSVITEKGD--VTTSFLLIQNADLADSGKYSCAPSNADVASV 267
            .|:..::.|:....|.|      .::....||  .|...|:|......|||.|:|.|||:...||
  Fly   544 IWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSV 608

  Fly   268 RVHVLNVRAIISGEHPEA--MQT-------GSSGCQYNWLTIVLLLGLV 307
            .:|||      |||:..:  |.|       |.|.| ::.|.::.:|||:
  Fly   609 DLHVL------SGEYSASAIMSTAARTTKGGRSTC-HSTLGLLGILGLL 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 42/92 (46%)
IG_like 80..175 CDD:214653 42/93 (45%)
IG_like 184..271 CDD:214653 29/94 (31%)
IGc2 191..262 CDD:197706 25/78 (32%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 35/76 (46%)
Ig 415..507 CDD:299845 41/91 (45%)
IG_like 521..612 CDD:214653 29/90 (32%)
IGc2 524..605 CDD:197706 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444696
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.