DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr5

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:347 Identity:124/347 - (35%)
Similarity:183/347 - (52%) Gaps:64/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IAHPLPLCVAWLLLLVVIVMSDMTNGGVQGPIE----------GYNSLDDLLTTTPTPGQAALLL 57
            |||  .:.|.:.:.|:||:       |:..|::          |:.:..:.|:.         |:
  Fly    35 IAH--EMLVEYFMALLVIM-------GLTAPVDKQSRRSSQYFGHLAAAEELSN---------LI 81

  Fly    58 PTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYT 122
            |....|       ::|.||.:|.|.|.|.:|.:|.|.||||:|.::.|||||.||:||||:|..|
  Fly    82 PDNYDA-------IDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMT 139

  Fly   123 YTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLH 187
            ||:||||.|.|..::::|.|:|...|:||||:||||:||:|..|...:|.||...|.||...:|.
  Fly   140 YTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELF 204

  Fly   188 VDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADS 252
            :..||.|||||....:|.|..::.|:...|::: ||:|||:.|.:|: .:.||.|:|......||
  Fly   205 IQSGSDINLTCIAPQAPGPYTHMLWHKDTELVS-DSARGGIRVESEQ-QMKTSNLVISRVQHTDS 267

  Fly   253 GKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQ--TGSSGCQYNWLTI----VLLLGLVLCYS 311
            |.|:|:..|::..||.||      ||..|...|||  .||.      |.:    :|||.::|   
  Fly   268 GNYTCSADNSNSDSVFVH------IIKSEQHAAMQHELGSR------LLLPPLPLLLLAVLL--- 317

  Fly   312 SQQCSSAVPASLTSSLPLPSQL 333
                  .|....||||.:.:.|
  Fly   318 ------VVLLGPTSSLQIRTPL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 7/16 (44%)
IG_like 80..175 CDD:214653 50/94 (53%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 3/7 (43%)
CDR1 97..104 CDD:409355 3/6 (50%)
FR2 105..114 CDD:409355 7/8 (88%)
Ig strand C 105..110 CDD:409355 4/4 (100%)
CDR2 115..129 CDD:409355 9/13 (69%)
Ig strand D 129..135 CDD:409355 3/5 (60%)
FR3 130..159 CDD:409355 13/28 (46%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 32/86 (37%)
Ig strand B 194..198 CDD:409353 3/3 (100%)
Ig strand C 209..213 CDD:409353 0/3 (0%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)
dpr5NP_650080.3 FR1 96..113 CDD:409355 7/16 (44%)
IG_like 98..179 CDD:214653 45/80 (56%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 3/5 (60%)
FR2 121..132 CDD:409355 7/10 (70%)
Ig strand C 121..127 CDD:409355 4/5 (80%)
Ig strand C' 130..133 CDD:409355 1/2 (50%)
CDR2 133..146 CDD:409355 8/12 (67%)
Ig strand D 146..151 CDD:409355 2/4 (50%)
FR3 147..176 CDD:409355 13/28 (46%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 28/73 (38%)
Ig strand B 211..215 CDD:409353 3/3 (100%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.