DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Ama

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:111/290 - (38%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RNVTALMGKSAYLSCRVRNLANKTVSWIR---HRDIH--ILTVGSYTYTSDQRFQATHHQDTED- 139
            ::|.|.:|.|...:|.|..:...:|||.:   ..|.:  :|::.:.....|||:..|..:..:. 
  Fly    40 KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTG 104

  Fly   140 ---WTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILG---GPDLHVDKGSTINLTC 198
               :|.:|:..:..|.|.||||:..........:|::.:.|..::.   .....|.:|..:.|||
  Fly   105 SAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQI
KTPPVIAENTPKSTLVTEGQNLELTC 169

  Fly   199 TVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNA- 262
            .....|:|.  |.|......:    ...|..::.|      ..|.|::....|.|.|.|...|. 
  Fly   170 HANGFPKPT--ISWAREHNAV----MPAGGHLLAE------PTLRIRSVHRMDRGGYYCIAQNGE 222

  Fly   263 ---DVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSSQQCS-SAVPASL 323
               |...:||.| ..|..|:.:.|:..|..|...:.                  :|| ...||..
  Fly   223 GQPDKRLIRVEV-EFRPQIAVQRPKIAQMVSHSAEL------------------ECSVQGYPAPT 268

  Fly   324 T----SSLPLPS----QLPLPAAAAATTTA 345
            .    :.:||.|    ::...|:::.|||:
  Fly   269 VVWHKNGVPLQSSRHHEVANTASSSGTTTS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/101 (24%)
IG_like 80..175 CDD:214653 24/102 (24%)
IG_like 184..271 CDD:214653 21/90 (23%)
IGc2 191..262 CDD:197706 16/70 (23%)
AmaNP_731114.2 I-set 33..143 CDD:254352 24/102 (24%)
Ig 37..127 CDD:299845 22/86 (26%)
IG_like 154..234 CDD:214653 21/91 (23%)
IGc2 161..223 CDD:197706 17/73 (23%)
I-set 254..330 CDD:254352 11/63 (17%)
IGc2 254..322 CDD:197706 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.