DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr11

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:332 Identity:123/332 - (37%)
Similarity:170/332 - (51%) Gaps:40/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LCVAWLLLLVVI----VMSDMTNGGVQGPIEGYN---------------SLDD-----LLTTTPT 49
            |.:..:|.|.:.    ..::...|.|.||..|.:               |.|:     ..|...:
  Fly    30 LLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSS 94

  Fly    50 PGQAALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIH 114
            ..|.:.|||.|...:.| ...:|||.|.....|||..:|..|||.|||:.|.||:|||||.||.|
  Fly    95 LAQVSSLLPEASALSAT-SGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGH 158

  Fly   115 ILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTAT 179
            ||||....:.:||||.|....| :.||||||:.|.||||.||||:||:|..|..|:|.||||...
  Fly   159 ILTVDRAVFIADQRFLAIKQPD-KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTE 222

  Fly   180 ILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSV------ITEKGDVT 238
            |||.||.:|..||.:.|.|.|:.:.|||.:|.|||..|.:..||.|....:      .:.:|..|
  Fly   223 ILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQST 287

  Fly   239 TSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC--QYNWLTIV 301
            ...|:|::|...|:|.|:|:|||:..|:|.::::|      ||...:..|.|:..  .|....:.
  Fly   288 IGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIIN------GESSASAVTSSAATTRAYALSILA 346

  Fly   302 LLLGLVL 308
            |||.::|
  Fly   347 LLLSVIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 52/94 (55%)
IG_like 80..175 CDD:214653 53/94 (56%)
IG_like 184..271 CDD:214653 33/92 (36%)
IGc2 191..262 CDD:197706 27/76 (36%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 52/91 (57%)
Ig 127..217 CDD:299845 51/90 (57%)
IG_like 227..320 CDD:214653 33/92 (36%)
IGc2 234..311 CDD:197706 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444702
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.