DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr16

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:123/289 - (42%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRF--------------- 129
            |.|.|...|:.|||.|::...:.|.:||:|.||.||:.|...|:.:|.||               
  Fly   205 PLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSG 269

  Fly   130 ------------------------QATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVR 170
                                    |...:..:..||||||:....|||.||||::|:|..|..|:
  Fly   270 GALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQ 334

  Fly   171 LNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGG-------- 227
            |.|:.|...::|.....|..||.:.|.|.|:.:.|.|.|||||..::.:..::...|        
  Fly   335 LFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQ 399

  Fly   228 ----VSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEH------ 282
                :...||....|...|:|.......||.|:|.|.|:..||:::|||      |||:      
  Fly   400 IDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVL------SGEYSASAIK 458

  Fly   283 -----PEAMQTGSSGCQYNWLTIVLLLGL 306
                 |..:..|.:.. :.|| |.||:.|
  Fly   459 STAARPHRLGHGYTSL-HQWL-IFLLVAL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 40/132 (30%)
IG_like 80..175 CDD:214653 41/133 (31%)
IG_like 184..271 CDD:214653 27/98 (28%)
IGc2 191..262 CDD:197706 23/82 (28%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 40/131 (31%)
Ig <298..338 CDD:299845 18/39 (46%)
IG_like 352..447 CDD:214653 27/94 (29%)
Ig 358..439 CDD:143165 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.