DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and LSAMP

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:352 Identity:88/352 - (25%)
Similarity:130/352 - (36%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLPTA-PTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVG 119
            ||||. |..:..        |:..|. |:|...|.:|.|.|.|.: .|..|:|:....  |:..|
Human    22 LLPTGLPVRSVD--------FNRGTD-NITVRQGDTAILRCVVED-KNSKVAWLNRSG--IIFAG 74

  Fly   120 SYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQ--PVRSYFVRLNVVVPTATILG 182
            ...::.|.|.:.......| ::|:|:.....|.|.|.|.:.||  |..|. |.|.|.||......
Human    75 HDKWSLDPRVELEKRHSLE-YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQ-VYLIVQVPPKISNI 137

  Fly   183 GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKG---DVTTSFLLI 244
            ..|:.|::||.:.|.|.....|||  .|.|.|                :|..|   :....:|.|
Human   138 SSDVTVNEGSNVTLVCMANGRPEP--VITWRH----------------LTPTGREFEGEEEYLEI 184

  Fly   245 QNADLADSGKYSCAPSN----ADVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLG 305
            .......||||.|..:|    |||..|:|.|.....|...:..||    ::|.|           
Human   185 LGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEA----TTGRQ----------- 234

  Fly   306 LVLCYSSQQC-SSAVPA----------SLTSSLPLPSQLPLPAAAAATTTATGESASSESVTAAR 359
                 :|.:| :|||||          .:.|:..|..:.....::...|..|.|...:.:..||.
Human   235 -----ASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAAN 294

  Fly   360 ASAATTTTTTATRKRCPAVKSCRQTAG 386
            ....|..:....::..|.:....|..|
Human   295 KLGVTNASLVLFKRVLPTIPHPIQEIG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 28/96 (29%)
IG_like 80..175 CDD:214653 28/96 (29%)
IG_like 184..271 CDD:214653 27/93 (29%)
IGc2 191..262 CDD:197706 20/77 (26%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 28/95 (29%)
Ig 132..215 CDD:386229 27/100 (27%)
Ig_3 219..294 CDD:372822 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.