DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr13

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:293 Identity:112/293 - (38%)
Similarity:151/293 - (51%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSA 91
            |.|::|.:|.       |..||.                        ||.......||..:|.:|
  Fly   160 NNGIEGGMES-------LFGTPM------------------------YFGTENSTVVTTQIGATA 193

  Fly    92 YLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYE 156
            ::.|.|.::....|||||.:|.|:||||..||:||:||.|||.:.:||||||||:.|.||||:||
  Fly   194 HVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYE 258

  Fly   157 CQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINY 221
            ||:||.|..|.|:.|:||...|.|.|.|..::..|||:.|.|.|..:.|...||||||...:|||
  Fly   259 CQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINY 323

  Fly   222 DSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAM 286
            |..| |::|.||. |..:|.|.||......||.::|..||...|||.||      |..|::|.||
  Fly   324 DIDR-GINVSTEP-DFQSSELTIQRTRREHSGNFTCVASNTQPASVLVH------IFKGDNPAAM 380

  Fly   287 QTGSSG-------CQYNWLTIVLLLGLVLCYSS 312
            ..|..|       .|.:.:.|::..|..:.::|
  Fly   381 YHGHVGGSTKTTQSQLHMIMIIIASGYRIFHTS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 49/94 (52%)
IG_like 80..175 CDD:214653 50/94 (53%)
IG_like 184..271 CDD:214653 37/86 (43%)
IGc2 191..262 CDD:197706 31/70 (44%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 49/95 (52%)
IG_like 182..262 CDD:214653 43/79 (54%)
IG_like 285..362 CDD:214653 32/78 (41%)
IGc2 292..361 CDD:197706 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.