DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Dscam2

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:334 Identity:82/334 - (24%)
Similarity:112/334 - (33%) Gaps:72/334 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRD------IH----ILTVGSYTYTS 125
            |||      |..|........:|.|........||.|: |.|      ||    :|..|  |...
  Fly    35 MEP------PGRVEFSNSSGGWLDCSASGSPQPTVDWV-HADGSAVTEIHGVRRVLRNG--TLVL 90

  Fly   126 DQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVR--SYFVRLNVVVPTATILGGPDLHV 188
            .....|.:|||..:             .:|.|..|....|  |..|::..||..|..:....|..
  Fly    91 MPFAAAAYHQDVHN-------------TIYRCIASNSVGRIVSRDVQVRAVVAQAYKVDVEVLSA 142

  Fly   189 DKGSTINLTCTV-KFSPEPPAYIFWYHHEEVINYDSSRG-GVSVITEKGDVTTSFLLIQNADLAD 251
            .:|.|..|.|.| .|..|....:.|.|...:..|.|.:| |...:...|:     |||.|...:|
  Fly   143 ARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGE-----LLIHNLQESD 202

  Fly   252 -SGKYSCAPSNADVASV------RVHVLNVRAIISG---EHPEAMQTGSSGCQYNWLTIVLLLGL 306
             |..:.|...:.....|      |:.:.:.|.|||.   ||...:|.....            |.
  Fly   203 ESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDE------------GA 255

  Fly   307 VLCYSSQQCSSAVPASLT--SSLPLP----SQLPLPAAAAATTTATGESASSESVTAARA---SA 362
            ||...:|.|.|...:..|  .:.|||    .::.|.....|....|||.:.....||...   ::
  Fly   256 VLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEAS 320

  Fly   363 ATTTTTTAT 371
            |....|.||
  Fly   321 AELRLTVAT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/106 (23%)
IG_like 80..175 CDD:214653 24/106 (23%)
IG_like 184..271 CDD:214653 24/95 (25%)
IGc2 191..262 CDD:197706 21/73 (29%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845 22/91 (24%)
Ig 138..>203 CDD:299845 19/69 (28%)
I-set 238..327 CDD:254352 21/100 (21%)
Ig 247..327 CDD:299845 19/91 (21%)
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.