DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and ImpL2

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:79/230 - (34%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWI-------RHRDIHILTVGSYTYTSDQ 127
            |::  |..:.|..:....|.:..:.|.:......::.|:       ...|:....|.....::..
  Fly    57 WLK--FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIV 119

  Fly   128 RFQATHHQDTEDWTLQIKWAQKRDAGMYECQIST-----------QPVRSYFVRLNVVVPTA--- 178
            |.:::|   ..|..|.       :|..|.|...|           .|.||..:......|.|   
  Fly   120 RVRSSH---IIDHVLS-------EARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKP 174

  Fly   179 TILGGPDLHVD-KGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFL 242
            .|:.....|:| .||.|.|.|.|  ...|.|.|.|.::|   |.:..:|....:...||     |
  Fly   175 RIIYTEKTHLDLMGSNIQLPCRV--HARPRAEITWLNNE---NKEIVQGHRHRVLANGD-----L 229

  Fly   243 LIQNADLADSGKYSCAPSNA---DVASVRVH-VLN 273
            ||......|.|.|.|...|.   |.|...|: |||
  Fly   230 LISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 17/112 (15%)
IG_like 80..175 CDD:214653 17/112 (15%)
IG_like 184..271 CDD:214653 28/91 (31%)
IGc2 191..262 CDD:197706 22/70 (31%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.