DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr20

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:262 Identity:88/262 - (33%)
Similarity:132/262 - (50%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HPKWMEPYFDP----STPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRD----------IHILT 117
            |.:...|:|:.    ....|:|...|.|.:|:||:..|.:|||||:||..          :.:||
  Fly   259 HDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLT 323

  Fly   118 VGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATI-- 180
            ||.:|||.|:|:: ...|...:|.|:|...:|.|..:|||||||.|.|...:.|:|..|...|  
  Fly   324 VGMHTYTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVD 387

  Fly   181 -LGGP--DLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITE-KGDVTTSF 241
             :|.|  :.:.:..||:.|:|.|:......:.:||.|.:.::|||.:||||||.|| ..|...|.
  Fly   388 EVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANST 452

  Fly   242 LLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGL 306
            |.|......|||.|:|:.|.....::.||:||..:.....|     .|:.|....|..:|:|..:
  Fly   453 LSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHH-----GGAVGWHSTWWNMVMLHAM 512

  Fly   307 VL 308
            .|
  Fly   513 AL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 40/104 (38%)
IG_like 80..175 CDD:214653 41/104 (39%)
IG_like 184..271 CDD:214653 31/89 (35%)
IGc2 191..262 CDD:197706 29/71 (41%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 34/87 (39%)
Ig 279..378 CDD:299845 39/99 (39%)
Ig 400..471 CDD:299845 28/70 (40%)
IG_like 402..480 CDD:214653 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444720
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.