DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and babos

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:227 Identity:61/227 - (26%)
Similarity:85/227 - (37%) Gaps:81/227 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ILTVG-----SYTYTS--DQRFQATHHQD--TEDWTL---QIKWAQKRDAGMYECQISTQPVRSY 167
            :|.||     ||..:|  |.:.||....|  .||.:.   |.|              |..||.|.
  Fly    13 LLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSPQTK--------------SPNPVASE 63

  Fly   168 FVRLNVVVPTATILGGPD--LHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSV 230
            .:...:.|   |.:.|.|  |..|.||.::.:..|         :.||..:.||    |.|    
  Fly    64 KINKTLSV---TGIRGEDVVLKCDVGSNLHSSDVV---------VLWYFGDNVI----SNG---- 108

  Fly   231 ITEKGDVTTSFLLIQNADLA-------DSGKYSC--APSNADVASVRVHVLNVRAIISGEH---- 282
               |..|..:|.|..|.||.       .:|.|.|  .||.:        |:|.:..|: ||    
  Fly   109 ---KNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGS--------VVNTKVTIA-EHSLDA 161

  Fly   283 --PEAMQT--GSS----GCQYNWLTIVLLLGL 306
              ||:..:  ||:    ||.....|::||||:
  Fly   162 IAPESSTSAAGSASSFLGCTVLASTVLLLLGM 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 18/70 (26%)
IG_like 80..175 CDD:214653 18/71 (25%)
IG_like 184..271 CDD:214653 24/97 (25%)
IGc2 191..262 CDD:197706 21/79 (27%)
babosNP_001286719.1 ig 70..154 CDD:278476 29/114 (25%)
IG_like 70..154 CDD:214653 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.