DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and wrapper

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:93/280 - (33%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLPLCVAWLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTA------PTAA 64
            |.|: :.|.|           ||.|..|.....:...|:....:..||.|:...|      |..|
  Fly   160 PQPV-ITWRL-----------NGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVA 212

  Fly    65 --YTHPKWMEPYFDP--STPRNVT-ALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYT 124
              |.|     ..|.|  |.|:.|. ..:|..|:|.|.|......||.|..|.  ..:.:|:::.|
  Fly   213 NVYLH-----VLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHG--LPVALGAHSTT 270

  Fly   125 SDQRFQAT----HHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPD 185
            .:...|..    |:.:.....|.:|..:..|.|.|||:.|.|        ::|...:..:.|.| 
  Fly   271 HESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQ--------ISVKSGSVELTGRP- 326

  Fly   186 LHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLA 250
                      :.|..|.:|               ...||...|.|..     |.|.|.|....| 
  Fly   327 ----------MPCLFKINP---------------GTQSSTSHVLVWQ-----TESLLPIMEFKL- 360

  Fly   251 DSGKYSCAPSNADVASVRVH 270
               |:...|||.....||.:
  Fly   361 ---KFRQIPSNNVTRQVRTN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/99 (24%)
IG_like 80..175 CDD:214653 25/99 (25%)
IG_like 184..271 CDD:214653 19/87 (22%)
IGc2 191..262 CDD:197706 15/70 (21%)
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 17/74 (23%)
Ig 147..219 CDD:299845 17/75 (23%)
I-set 224..323 CDD:254352 26/108 (24%)
IGc2 236..314 CDD:197706 22/87 (25%)
FN3 339..431 CDD:238020 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.