DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr19

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:324 Identity:97/324 - (29%)
Similarity:142/324 - (43%) Gaps:92/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQ 135
            ::..|:......|.|..|..|.|.|.|:..:..||||||.:|..:||||..|::||:||...|.:
  Fly    38 LQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTR 102

  Fly   136 DTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTV 200
            ....|:|:||..::.|.|.||||:|..|.:|..:.|.:|...|.|...|:||:|:.||:.|.|.:
  Fly   103 HMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKL 167

  Fly   201 KFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKG------------------------------ 235
            |.:.|.||::||||..::|||| |:||. |:|..|                              
  Fly   168 KRATENPAFVFWYHDSKMINYD-SQGGF-VVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGV 230

  Fly   236 -----------------------------------DVTTSFLLIQNADLADSGKYSCAPSNADVA 265
                                               :.:.|.|.::..:...:|.|:||||||..|
  Fly   231 LNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPA 295

  Fly   266 SVRVHVLNVRAIISGEHPEAMQ----------TGSSGCQYNWLTI--------VLLLGLVLCYS 311
            |:.||||.      ||...|||          |..:| .:..:|:        |.|.|.:|.:|
  Fly   296 SITVHVLR------GEKTAAMQHANRSILDTETNGNG-TFGLITLGGLNGTSGVTLAGGILYFS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 5/16 (31%)
IG_like 80..175 CDD:214653 38/94 (40%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 3/7 (43%)
CDR1 97..104 CDD:409355 1/6 (17%)
FR2 105..114 CDD:409355 6/8 (75%)
Ig strand C 105..110 CDD:409355 4/4 (100%)
CDR2 115..129 CDD:409355 7/13 (54%)
Ig strand D 129..135 CDD:409355 2/5 (40%)
FR3 130..159 CDD:409355 10/28 (36%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 39/151 (26%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)
dpr19NP_609392.1 IG_like 50..127 CDD:214653 34/76 (45%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 3/3 (100%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 3/4 (75%)
Ig <265..298 CDD:472250 12/32 (38%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 2/4 (50%)

Return to query results.
Submit another query.