DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:264 Identity:79/264 - (29%)
Similarity:112/264 - (42%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NG-GVQGPIEGYNSLDDLLTTTPTPGQAALLL----PTAPTA----AYTHPKWMEPYFDPSTPRN 82
            || |..||:.|..      |.:...|...:::    ...||:    ....|::.| |.:     |
  Fly    69 NGAGGGGPVAGSG------TGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTE-YIE-----N 121

  Fly    83 VTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATH--HQDTEDWTLQIK 145
            ||...|::..|.|.|:||.:..|:|:......||||.::..|.:.|...||  |.....|.|.|.
  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHIN 186

  Fly   146 WAQKRDAGMYECQISTQPVRSYFVRLNVVVP--TATILGGPDLHVDKGSTINLTCTVKFSPEPPA 208
            ...:.|.|.|.|||:|...::.|..||||||  ....|...|:.|.:|:.|:|.|....||.|  
  Fly   187 NVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP-- 249

  Fly   209 YIFWYHHEEVINYDSSRGGVS---VITE-KGDVTTSFLLIQNADLADSGKYSCAPSNA--DVASV 267
            .|.|...      |:||..::   ::.| :||.    |.|......|.|.|.|..||.  ...|.
  Fly   250 IIKWKRD------DNSRIAINKNHIVNEWEGDT----LEITRISRLDMGAYLCIASNGVPPTVSK 304

  Fly   268 RVHV 271
            |:.|
  Fly   305 RIKV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 33/96 (34%)
IG_like 80..175 CDD:214653 34/96 (35%)
IG_like 184..271 CDD:214653 27/92 (29%)
IGc2 191..262 CDD:197706 22/74 (30%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 34/100 (34%)
Ig 130..200 CDD:143165 23/69 (33%)
I-set 226..310 CDD:254352 28/95 (29%)
IGc2 233..298 CDD:197706 23/76 (30%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.