Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723103.1 | Gene: | DIP-theta / 33795 | FlyBaseID: | FBgn0051646 | Length: | 606 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 63/196 - (32%) |
---|---|---|---|
Similarity: | 93/196 - (47%) | Gaps: | 15/196 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 RNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIK 145
Fly 146 WAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGP---DLHVDKGSTINLTCTVKFSPEPP 207
Fly 208 AYIFWYHH-EEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHV 271
Fly 272 L 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 31/92 (34%) |
IG_like | 80..175 | CDD:214653 | 32/93 (34%) | ||
IG_like | 184..271 | CDD:214653 | 25/90 (28%) | ||
IGc2 | 191..262 | CDD:197706 | 21/71 (30%) | ||
DIP-theta | NP_723103.1 | Ig | 137..230 | CDD:299845 | 32/93 (34%) |
IG_like | 137..230 | CDD:214653 | 32/93 (34%) | ||
IG_like | 240..324 | CDD:214653 | 25/91 (27%) | ||
IGc2 | 247..310 | CDD:197706 | 20/71 (28%) | ||
Ig | 327..419 | CDD:299845 | |||
IG_like | 343..420 | CDD:214653 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |