DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:196 Identity:63/196 - (32%)
Similarity:93/196 - (47%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIK 145
            :|||..:.:.|.|.|.|.||....::|:|.....|||:.::..|.:.|...| |.:...|.|:|:
  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSIT-HAEKRAWILRIR 200

  Fly   146 WAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGP---DLHVDKGSTINLTCTVKFSPEPP 207
            ..::.|.|.|.|||:|.|::|....|:|||| ..||..|   |:.:.:||.:.|.|....||.|.
  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMVIREGSNVTLKCAATGSPTPT 264

  Fly   208 AYIFWYHH-EEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHV 271
              |.|... .|:|...:   |...:...|    |||.|...:..:.|.|.|..||....:|...|
  Fly   265 --ITWRREGGELIPLPN---GAEAVAYNG----SFLTIAKVNRLNMGAYLCIASNGIPPTVSKRV 320

  Fly   272 L 272
            :
  Fly   321 M 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 31/92 (34%)
IG_like 80..175 CDD:214653 32/93 (34%)
IG_like 184..271 CDD:214653 25/90 (28%)
IGc2 191..262 CDD:197706 21/71 (30%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 32/93 (34%)
IG_like 137..230 CDD:214653 32/93 (34%)
IG_like 240..324 CDD:214653 25/91 (27%)
IGc2 247..310 CDD:197706 20/71 (28%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.