DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and fipi

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:198 Identity:42/198 - (21%)
Similarity:71/198 - (35%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VRNLANKT-VSWIRHRDIHILTVGSYT---YTSD--------------------------QRFQA 131
            :.|||..| |:|..|.:...|:...::   ||::                          :....
  Fly     7 ILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGR 71

  Fly   132 THHQDTEDWTLQIKWAQ--KRDAGMYECQISTQPVRSYFVRLNV-----VVPTATILGGPDLHVD 189
            .|.:.|....|:|.:|.  ..|.|.:.|:.:...:.|....|.|     ....||:     :.|.
  Fly    72 IHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATV-----MTVK 131

  Fly   190 KGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGK 254
            :|....:.|.||..|:|  .:.|:.:.:.|    |.|...  ..|..:....|||......|:|:
  Fly   132 EGEKATILCEVKGEPQP--NVTWHFNGQPI----SAGAAD--DSKFRILADGLLINKVTQNDTGE 188

  Fly   255 YSC 257
            |:|
  Fly   189 YAC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 21/113 (19%)
IG_like 80..175 CDD:214653 21/114 (18%)
IG_like 184..271 CDD:214653 19/74 (26%)
IGc2 191..262 CDD:197706 18/67 (27%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 12/81 (15%)
I-set 128..202 CDD:254352 19/72 (26%)
Ig 133..>193 CDD:299845 18/67 (27%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.