Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 71/198 - (35%) | Gaps: | 50/198 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 VRNLANKT-VSWIRHRDIHILTVGSYT---YTSD--------------------------QRFQA 131
Fly 132 THHQDTEDWTLQIKWAQ--KRDAGMYECQISTQPVRSYFVRLNV-----VVPTATILGGPDLHVD 189
Fly 190 KGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGK 254
Fly 255 YSC 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 21/113 (19%) |
IG_like | 80..175 | CDD:214653 | 21/114 (18%) | ||
IG_like | 184..271 | CDD:214653 | 19/74 (26%) | ||
IGc2 | 191..262 | CDD:197706 | 18/67 (27%) | ||
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 12/81 (15%) |
I-set | 128..202 | CDD:254352 | 19/72 (26%) | ||
Ig | 133..>193 | CDD:299845 | 18/67 (27%) | ||
IG_like | 228..307 | CDD:214653 | |||
Ig | 235..305 | CDD:143165 | |||
FN3 | 312..415 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |