DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and bdl

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:327 Identity:67/327 - (20%)
Similarity:114/327 - (34%) Gaps:78/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIAHPLPLCVAWLLLLVVIV--------MSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLP 58
            |...|:|..|.|......|.        .|::.||.:.           |:...|..|:|::.|.
  Fly    60 PFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLH-----------LVENHPEFGRASVNLT 113

  Fly    59 TAPTA--AYTHPKWMEPYFDPST--------------------PRNVTALMGKSAYLSCRVRNLA 101
            ....:  .:.|.:...|...||.                    |.|.|...|::|:..|.:::..
  Fly   114 AIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPE 178

  Fly   102 NKTVSWIRH----RDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQI--- 159
            |...||.:.    :::..|.         :||..     ..|.:|.|......|.|.|||::   
  Fly   179 NSQASWYKDGVLLQEVQDLV---------RRFYM-----GPDGSLSIDPTMMSDLGEYECKVRNS 229

  Fly   160 --STQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYD 222
              ..|..:::   ||:......|...|::.:..|....|.|..:.:| |...:.|  .::.:.:|
  Fly   230 DGELQTAKAF---LNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANP-PLKNLRW--EKDGLLFD 288

  Fly   223 SSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN---ADVASVRVHVLNVRAIISGEHPE 284
            |.  .|..:..|   ....|.....|...:|.|:|.|.|   .|..|..:.|:.:|..|....|:
  Fly   289 SY--NVPGVFYK---MNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPK 348

  Fly   285 AM 286
            |:
  Fly   349 AI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 23/123 (19%)
IG_like 80..175 CDD:214653 23/103 (22%)
IG_like 184..271 CDD:214653 20/89 (22%)
IGc2 191..262 CDD:197706 17/73 (23%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/78 (19%)
Ig 43..131 CDD:299845 15/81 (19%)
I-set 153..242 CDD:254352 22/105 (21%)
Ig 157..242 CDD:299845 22/101 (22%)
Ig_2 252..337 CDD:290606 21/92 (23%)
IG_like 260..327 CDD:214653 17/74 (23%)
I-set 341..428 CDD:254352 3/10 (30%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.