DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr2

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:338 Identity:126/338 - (37%)
Similarity:171/338 - (50%) Gaps:74/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLAN 102
            ||:||.......|.:..           |:|   .|.||...|||:|...|.:|.::|||.||.:
  Fly    85 NSIDDEREAEEQPPEET-----------TYP---PPVFDFGMPRNITTRTGHTAAINCRVDNLGD 135

  Fly   103 KTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSY 167
            |:|||||.||:||||.|..|||||:||:.....|::||||.:|:||.||:|:||||::|:|..|.
  Fly   136 KSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISM 200

  Fly   168 FVRLNVVV--PTA-TILGGP-DLHVDKGSTINLTCTVKFSPEPPAY----IFWYH---------- 214
            ..||||:|  |.| .|:.|| ||:|..||::.|||.|| .|...|.    |:||.          
  Fly   201 AFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVK-QPATSAQDIGPIYWYRGPYILTPFVA 264

  Fly   215 HEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIIS 279
            |......|..|  :|:.:...:...|.|.|.||.|.|:|.|:|.|:.|:.|||.|:|:|      
  Fly   265 HPNDAAIDLQR--ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVIN------ 321

  Fly   280 GEHPEAMQTG----SSGCQYNWLTIVLLLGLVL-----------------CYSSQQCSSA----- 318
            .|.|.|||..    :||...: ..:||||.:|.                 |:.|  ||:.     
  Fly   322 DESPAAMQKSRAIRTSGSMRS-SRLVLLLAMVASSVVRWLIGGQRIGSNSCHDS--CSNLSTLHI 383

  Fly   319 ----VPASLTSSL 327
                :.|.:||.|
  Fly   384 NYCNLRAKITSHL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 52/94 (55%)
IG_like 80..175 CDD:214653 53/94 (56%)
IG_like 184..271 CDD:214653 36/101 (36%)
IGc2 191..262 CDD:197706 27/84 (32%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 51/92 (55%)
Ig 116..192 CDD:299845 42/75 (56%)
ig 220..306 CDD:278476 29/88 (33%)
IG_like 220..306 CDD:214653 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444730
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.