DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr3

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:316 Identity:112/316 - (35%)
Similarity:154/316 - (48%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYFDPSTPRNVTALMGKS-AYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136
            |.||...|||:|...|.: |.:.|||.:|.:|:|||||.||:||||||:.|||||:|||.|..:|
  Fly   236 PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300

  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVV----PTATILGGPDLHVDKGSTINLT 197
            :.:|||.:|....:|:|:||||::|:|..|...:||::.    ..|.|.|.||||...||.|.|.
  Fly   301 SREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILN 365

  Fly   198 CTVKFSPEPPAY----IFWYHHEEVIN-YDSSRG------------------------------- 226
            |.|:   :|...    |:||..|.:|. :|:..|                               
  Fly   366 CLVQ---QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQ 427

  Fly   227 -----GVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAM 286
                 .:::.::.||...|.|.|.||...|:|.|:|.|:.|..|||.|||:|      .|:|.||
  Fly   428 MEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVIN------DENPAAM 486

  Fly   287 Q-TGSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAA 341
            | :|:..|...  .:.|||.|:|                    ||..|.|.|..||
  Fly   487 QKSGACPCALG--PLQLLLHLLL--------------------LPELLLLRAGLAA 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 49/95 (52%)
IG_like 80..175 CDD:214653 49/95 (52%)
IG_like 184..271 CDD:214653 35/127 (28%)
IGc2 191..262 CDD:197706 26/111 (23%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 46/86 (53%)
IG_like 243..329 CDD:214653 46/85 (54%)
Ig 350..464 CDD:299845 29/116 (25%)
IG_like <441..477 CDD:214653 17/35 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444733
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.