DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr4

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:227 Identity:124/227 - (54%)
Similarity:159/227 - (70%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRF 129
            |....:.:||||.|:.|.|||.:|::|.|.||||||.::.|||||.||:||||||..|||:||||
  Fly    37 YWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRF 101

  Fly   130 QATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTI 194
            |:.|.:.:::|||:|...|.||:|.||||:||:|..|...||||||..|.|||..:|.:..||.|
  Fly   102 QSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDI 166

  Fly   195 NLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAP 259
            ||||....||.||::|:||..:.|:|| |.|||::||||: ...||.|||..|..||||.|:|:|
  Fly   167 NLTCLAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVITER-STRTSKLLIAKATPADSGNYTCSP 229

  Fly   260 SNADVASVRVHVLNVRAIISGEHPEAMQTGSS 291
            |::|.|||.|||:|      ||||.|||.|:|
  Fly   230 SSSDSASVVVHVIN------GEHPAAMQHGNS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 54/94 (57%)
IG_like 80..175 CDD:214653 55/94 (59%)
IG_like 184..271 CDD:214653 45/86 (52%)
IGc2 191..262 CDD:197706 39/70 (56%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 54/92 (59%)
IG_like 53..145 CDD:214653 53/91 (58%)
ig 153..227 CDD:278476 39/75 (52%)
IG_like 161..>227 CDD:214653 36/67 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444741
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105520
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
98.790

Return to query results.
Submit another query.