DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Opcml

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:115/274 - (41%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLPT-APTAA--YTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILT 117
            |:|| .|..:  .|.||.|:         |||...|:||.|.|.:.:...: |:|:....  ||.
Mouse    24 LVPTGVPVRSGDATFPKAMD---------NVTVRQGESATLRCTIDDRVTR-VAWLNRST--ILY 76

  Fly   118 VGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQIST--QPVRSYFVRLNVVVPTATI 180
            .|:..::.|.|.....:..|: :::.|:.....|.|.|.|.:.|  .|..|. |.|.|.||...:
Mouse    77 AGNDKWSIDPRVIILVNTPTQ-YSIMIQNVDVYDEGPYTCSVQTDNHPKTSR-VHLIVQVPPQIM 139

  Fly   181 LGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQ 245
            ....|:.|::||::.|.|.....|||.  :.|.|    ::....:|.||        ...:|.|.
Mouse   140 NISSDITVNEGSSVTLLCLAIGRPEPT--VTWRH----LSVKEGQGFVS--------EDEYLEIS 190

  Fly   246 NADLADSGKYSCAPSN----ADVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGL 306
            :.....||:|.|:..|    .||..|::.| |....||    :|..||.|..|         .|:
Mouse   191 DIKRDQSGEYECSALNDVAAPDVRKVKITV-NYPPYIS----KAKNTGVSVGQ---------KGI 241

  Fly   307 VLCYSSQQCSSAVP 320
            :.|.     :||||
Mouse   242 LSCE-----ASAVP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 7/16 (44%)
IG_like 80..175 CDD:214653 27/96 (28%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 4/7 (57%)
CDR1 97..104 CDD:409355 0/6 (0%)
FR2 105..114 CDD:409355 2/8 (25%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 4/13 (31%)
Ig strand D 129..135 CDD:409355 0/5 (0%)
FR3 130..159 CDD:409355 6/28 (21%)
Ig strand E 139..145 CDD:409355 0/5 (0%)
Ig strand F 153..160 CDD:409355 3/6 (50%)
IG_like 184..271 CDD:214653 24/90 (27%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 0/3 (0%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 0/2 (0%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 26/92 (28%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/3 (33%)
Ig_3 135..206 CDD:464046 21/84 (25%)
Ig 224..312 CDD:472250 13/45 (29%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.