DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr18

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:375 Identity:100/375 - (26%)
Similarity:148/375 - (39%) Gaps:110/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PIEGYNSLDDLLTTT-PTPGQAALLLPTA--------------------------PTAAYTHPKW 70
            ||:...:.|.|.|.| ||...|:|.:..:                          |.:.:.|...
  Fly   150 PIKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHH 214

  Fly    71 MEPYFDPSTPRN--------VTAL-MGKSAYLSCRVRNLANKTVSWIRH--RDIHILTVGSYTYT 124
            ..|:|:  .|.|        |:|: :...|.|:|||..|.:|||.|:|.  ..:.:||||:.||:
  Fly   215 WGPFFE--EPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYS 277

  Fly   125 SDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGG-----P 184
            .|.|.: ...|...:|.|.|...|..|||:|.||:||.|.|.:...|.|:.|...|:..     .
  Fly   278 GDPRIR-VKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVG 341

  Fly   185 DLHVDKGSTINLTCTV---------------------------------------------KFSP 204
            |.:...|||::|.|.:                                             |||.
  Fly   342 DRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSG 406

  Fly   205 EP-----PAYIFWYHHEEVINYDSSRGGVSVITEKGDV-TTSFLLIQNADLADSGKYSCAPSNAD 263
            :.     ..:|.|...||.:...::| .:||    .|| .||.:.|.:|.|:|||.|||:.....
  Fly   407 QDLEKYFTKFITWAKDEEPLQGMTNR-RLSV----SDVWLTSRISIGDAKLSDSGNYSCSLGRLF 466

  Fly   264 VASVRVHVLNVRAIISGEHPEAMQ--TGSSGCQYNWLTIVLLLGLVLCYS 311
            ...|:|.||      :||.|.|:|  .||....|:...:..||.|:..::
  Fly   467 TVIVQVQVL------TGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 39/105 (37%)
IG_like 80..175 CDD:214653 40/105 (38%)
IG_like 184..271 CDD:214653 31/137 (23%)
IGc2 191..262 CDD:197706 28/121 (23%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 35/83 (42%)
Ig <258..326 CDD:299845 26/68 (38%)
IGc2 <417..461 CDD:197706 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.