DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:385 Identity:99/385 - (25%)
Similarity:149/385 - (38%) Gaps:99/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLTTTPT----PGQAA-LLLPTAPTAA--YTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNL 100
            |:|.|||    |.:.. ..|.|..||.  ...|::.||.      .|||..:|:.|.::|.|.||
  Fly    42 LMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPI------ANVTVSVGRDALMACVVENL 100

  Fly   101 ANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVR 165
            ....|:|:|.....||::.....:.:.|...|:: |...|.|.||..::.|.|.|.||::|.|:|
  Fly   101 KGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN-DHRSWYLHIKEVEETDRGWYMCQVNTDPMR 164

  Fly   166 SYFVRLNVVVPTATILG--GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHH--EEVINYDSSRG 226
            |....|.||||...:.|  ..|:.|.:|..|:|.|..:..|||  |:.|...  ||::     .|
  Fly   165 SRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEP--YVMWRREDGEEML-----IG 222

  Fly   227 GVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASV--RVH-------VLNVRAIISGEH 282
            |..|....|::    |.|..........|.|..||....|:  |||       :|::...:.|.:
  Fly   223 GEHVNVVDGEL----LHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAY 283

  Fly   283 PEAMQTGSSGCQYNWLTIVLLLG---LVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAATTT 344
                                 ||   ::.|:     :.|.|||:.                ..||
  Fly   284 ---------------------LGQDVILECH-----TEAYPASIN----------------YWTT 306

  Fly   345 ATGESASSESVTAARASAATTTTTTATR----------------KRCPAVKSCRQTAGRV 388
            ..|:...|::..|......|:|.:..|:                .||.|..|..:|.|.:
  Fly   307 ERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 31/94 (33%)
IG_like 80..175 CDD:214653 32/94 (34%)
IG_like 184..271 CDD:214653 27/97 (28%)
IGc2 191..262 CDD:197706 20/72 (28%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 31/98 (32%)
IG_like 82..174 CDD:214653 32/92 (35%)
IG_like 184..267 CDD:214653 27/93 (29%)
IGc2 191..255 CDD:197706 21/74 (28%)
IG_like 282..368 CDD:214653 21/127 (17%)
Ig 288..367 CDD:143165 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.