DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:385 Identity:99/385 - (25%)
Similarity:149/385 - (38%) Gaps:99/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLTTTPT----PGQAA-LLLPTAPTAA--YTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNL 100
            |:|.|||    |.:.. ..|.|..||.  ...|::.||.      .|||..:|:.|.::|.|.||
  Fly    42 LMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPI------ANVTVSVGRDALMACVVENL 100

  Fly   101 ANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVR 165
            ....|:|:|.....||::.....:.:.|...|:: |...|.|.||..::.|.|.|.||::|.|:|
  Fly   101 KGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN-DHRSWYLHIKEVEETDRGWYMCQVNTDPMR 164

  Fly   166 SYFVRLNVVVPTATILG--GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHH--EEVINYDSSRG 226
            |....|.||||...:.|  ..|:.|.:|..|:|.|..:..|||  |:.|...  ||::     .|
  Fly   165 SRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEP--YVMWRREDGEEML-----IG 222

  Fly   227 GVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASV--RVH-------VLNVRAIISGEH 282
            |..|....|::    |.|..........|.|..||....|:  |||       :|::...:.|.:
  Fly   223 GEHVNVVDGEL----LHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAY 283

  Fly   283 PEAMQTGSSGCQYNWLTIVLLLG---LVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAATTT 344
                                 ||   ::.|:     :.|.|||:.                ..||
  Fly   284 ---------------------LGQDVILECH-----TEAYPASIN----------------YWTT 306

  Fly   345 ATGESASSESVTAARASAATTTTTTATR----------------KRCPAVKSCRQTAGRV 388
            ..|:...|::..|......|:|.:..|:                .||.|..|..:|.|.:
  Fly   307 ERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 5/16 (31%)
IG_like 80..175 CDD:214653 32/94 (34%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 3/6 (50%)
FR2 105..114 CDD:409355 3/8 (38%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 2/13 (15%)
Ig strand D 129..135 CDD:409355 1/5 (20%)
FR3 130..159 CDD:409355 10/28 (36%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 4/6 (67%)
IG_like 184..271 CDD:214653 27/97 (28%)
Ig strand B 194..198 CDD:409353 2/3 (67%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 3/9 (33%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 32/92 (35%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 28/101 (28%)
Ig strand B 195..199 CDD:409301 2/3 (67%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/7 (14%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 21/127 (17%)
Ig strand B 288..292 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 0/19 (0%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.