DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and dpr14

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:324 Identity:112/324 - (34%)
Similarity:163/324 - (50%) Gaps:41/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLT------------TTPTPGQAALLLPTAPTAAY 65
            |:|.::...:..:.:|.....::...:.|...|            .|.||....|.:    |...
  Fly     7 WILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEV----TETT 67

  Fly    66 THPKWMEPYF-DPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHR--DIHILTVGSYTYTSDQ 127
            ||..:  |:| ||.|..|::..:..|.||.|||.:|..|||||:|.|  |:.::|.|.:||:.|.
  Fly    68 THEPF--PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDS 130

  Fly   128 RFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATIL-----GGPDLH 187
            |: :...::..||.|.|::|.:||.|.||||:|:.|.....|.|.::||...||     ..|:.:
  Fly   131 RY-SLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKY 194

  Fly   188 VDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDV----TTSFLLIQNAD 248
            ...||||.|.|.:...|.|.:||.|.|...::|||:||||:||   |.|:    ..|.|.|.||:
  Fly   195 YKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISV---KTDMLPGRALSRLYIANAN 256

  Fly   249 LADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGCQ-YNWLTIVLLLGLVLCYS 311
            ..|:|.|:|...|....:|.|||||      ||.|.|||..:...| .|..|:|:|..:.:|.|
  Fly   257 RQDTGNYTCMLGNEITETVVVHVLN------GEEPAAMQHANGSRQKANASTMVVLFLVYVCIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 39/96 (41%)
IG_like 80..175 CDD:214653 38/96 (40%)
IG_like 184..271 CDD:214653 36/90 (40%)
IGc2 191..262 CDD:197706 32/74 (43%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 34/80 (43%)
Ig 84..169 CDD:299845 35/85 (41%)
IG_like 191..279 CDD:214653 36/90 (40%)
Ig 201..274 CDD:143165 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444723
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.