Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 58/200 - (28%) |
---|---|---|---|
Similarity: | 91/200 - (45%) | Gaps: | 12/200 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136
Fly 137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATIL--GGPDLHVDKGSTINLTCT 199
Fly 200 VKFSPEPPAYIFWYHHE--EVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNA 262
Fly 263 DVASV 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 28/94 (30%) |
IG_like | 80..175 | CDD:214653 | 29/94 (31%) | ||
IG_like | 184..271 | CDD:214653 | 22/85 (26%) | ||
IGc2 | 191..262 | CDD:197706 | 18/72 (25%) | ||
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 24/80 (30%) |
Ig | 51..131 | CDD:299845 | 24/80 (30%) | ||
I-set | 144..240 | CDD:254352 | 23/94 (24%) | ||
IGc2 | 159..228 | CDD:197706 | 19/74 (26%) | ||
Ig | 244..337 | CDD:299845 | |||
I-set | 244..337 | CDD:254352 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |