DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:200 Identity:58/200 - (28%)
Similarity:91/200 - (45%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136
            :|.|..|. .||:..:|:.|..:|.||:|....|.|::.....|..:.....|.:.|...: |.|
  Fly    41 QPEFVESI-SNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVS-HLD 103

  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATIL--GGPDLHVDKGSTINLTCT 199
            ...|.|.||...:.|.|.|.||::|.|::|....|:||:|...|.  ...|:.|.:||::.|||.
  Fly   104 QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCR 168

  Fly   200 VKFSPEPPAYIFWYHHE--EVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNA 262
            .:..|||  .:.|...:  |::..|:........:.:|:|    |.:......:.|.|.|..||.
  Fly   169 ARGYPEP--IVTWRREDGNEIVLKDNVGTKTLAPSFRGEV----LKLSKISRNEMGSYLCIASNG 227

  Fly   263 DVASV 267
            ...||
  Fly   228 VPPSV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 28/94 (30%)
IG_like 80..175 CDD:214653 29/94 (31%)
IG_like 184..271 CDD:214653 22/85 (26%)
IGc2 191..262 CDD:197706 18/72 (25%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 24/80 (30%)
Ig 51..131 CDD:299845 24/80 (30%)
I-set 144..240 CDD:254352 23/94 (24%)
IGc2 159..228 CDD:197706 19/74 (26%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.