DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:243 Identity:66/243 - (27%)
Similarity:101/243 - (41%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQI 144
            |.:.|.:.|..|.|.|.:.|.:. .|.|.  :|...|.:|. ...:..|::.....|...:.|:|
  Rat    59 PADQTVVAGHRAVLPCVLLNYSG-IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAGQYNLEI 119

  Fly   145 KWAQKRDAGMYECQISTQPVRSYFVRLNVVVP--TATILGGPDLHVDKGSTINLTCTVKFSPEPP 207
            ..|:..|...||||.:...:||...:|.|::|  ...|.|||.:.:..|:..||||.. |:.:|.
  Rat   120 TDAELSDDASYECQATEAALRSRRAKLTV
LIPPEDTRIDGGPVILLQAGTPYNLTCRA-FNAKPA 183

  Fly   208 AYIFWYHHEEVINYDSSRGGVSVITE-----KGDVTTSFLLIQNADLADSGK-YSC-----APSN 261
            |.|.|:..      .:.:.|....||     |.:.|.|.||||..|| |.|: ::|     |..|
  Rat   184 ATIIWFRD------GTQQEGAVTSTELLKDGKRETTISQLLIQPTDL-DIGRVFTCRSMNEAIPN 241

  Fly   262 ADVASVRVHVLNVRAIISGEHPEAMQTGSS---GCQ---------YNW 297
            ....|:.:.|.:...:.....|:.:..|..   .||         |.|
  Rat   242 GKETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 25/93 (27%)
IG_like 80..175 CDD:214653 26/94 (28%)
IG_like 184..271 CDD:214653 29/97 (30%)
IGc2 191..262 CDD:197706 26/81 (32%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 25/92 (27%)
Ig 57..148 CDD:299845 25/92 (27%)
Ig2_KIRREL3-like 170..251 CDD:143236 27/88 (31%)
I-set 255..336 CDD:254352 6/35 (17%)
Ig_2 259..337 CDD:290606 6/31 (19%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.