DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:322 Identity:80/322 - (24%)
Similarity:122/322 - (37%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKW 146
            |:|...|.:|.|.|.|.: .|..|:|:....  |:..|...::.|.|.:.......| ::|:|:.
  Rat    57 NITVRQGDTAILRCVVED-KNSKVAWLNRSG--IIFAGHDKWSLDPRVELEKRHALE-YSLRIQK 117

  Fly   147 AQKRDAGMYECQISTQ--PVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAY 209
            ....|.|.|.|.:.||  |..|. |.|.|.||........|:.|::||.:.|.|.....|||  .
  Rat   118 VDVYDEGSYTCSVQTQHEPKTSQ-VYLIV
QVPPKISNISSDVTVNEGSNVTLVCMANGRPEP--V 179

  Fly   210 IFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN----ADVASVRVH 270
            |.|.|             ::.:..:.:....:|.|.......||||.|..:|    |||..|:|.
  Rat   180 ITWRH-------------LTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVT 231

  Fly   271 VLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSSQQC-SSAVPA----------SLT 324
            |.....|...:..||    ::|.|                :|.:| :|||||          .:.
  Rat   232 VNYPPTITESKSNEA----TTGRQ----------------ASLKCEASAVPAPDFEWYRDDTRIN 276

  Fly   325 SSLPLPSQLPLPAAAAATTTATGESASSESVTAARASAATTTTTTATRKRCPAVKSCRQTAG 386
            |:..|..:.....::...|..|.|...:.:..||.....|..:....::..|.|....|..|
  Rat   277 SANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 27/93 (29%)
IG_like 80..175 CDD:214653 28/94 (30%)
IG_like 184..271 CDD:214653 25/90 (28%)
IGc2 191..262 CDD:197706 18/74 (24%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 27/92 (29%)
FR1 55..71 CDD:409353 5/13 (38%)
Ig strand A' 56..62 CDD:409353 2/4 (50%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 1/4 (25%)
FR2 77..84 CDD:409353 2/6 (33%)
Ig strand C 77..83 CDD:409353 2/5 (40%)
CDR2 85..95 CDD:409353 2/11 (18%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 9/35 (26%)
Ig strand D 100..107 CDD:409353 1/6 (17%)
Ig strand E 110..116 CDD:409353 2/6 (33%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 2/3 (67%)
Ig strand G 136..145 CDD:409353 4/9 (44%)
FR4 138..145 CDD:409353 3/7 (43%)
Ig_3 148..218 CDD:404760 20/84 (24%)
Ig strand A' 155..160 CDD:409353 1/4 (25%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 2/5 (40%)
Ig strand F 210..217 CDD:409353 4/6 (67%)
Ig strand G 224..232 CDD:409353 4/7 (57%)
Ig_3 235..311 CDD:404760 18/95 (19%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 0/3 (0%)
Ig strand F 304..309 CDD:409353 0/4 (0%)
Ig strand G 318..321 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.