DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Ncam2

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:211 Identity:51/211 - (24%)
Similarity:83/211 - (39%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDA 152
            |:.|.:.|||.:.....|||:.|.:       ..|...|.||....:.:     |||....|.|.
  Rat   129 GEDAEVVCRVSSSPAPAVSWLYHNE-------EVTTIPDNRFAVLANNN-----LQILNINKSDE 181

  Fly   153 GMYECQISTQ-----PVRSYFVRLNVVVPTATILGGPDLH--VDKGSTINLTCTVKFSPEPPAYI 210
            |:|.|:...:     ..|...|.:|  ||.|.::.....:  .::|..:.|||....||:|.  |
  Rat   182 GIYRCEGRVEARG
EIDFRDIIVIVN--VPPAIVMPQKSFNATAERGEEMTLTCKASGSPDPA--I 242

  Fly   211 FWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNAD---------VAS 266
            .|:.:.::|..:..      ...||..|.  |.::|....|.|.|.|..:|..         ...
  Rat   243 SWFRNGKLIEENEK------YILKGSNTE--LTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVF 299

  Fly   267 VRVHVLNVRAIISGEH 282
            |:.|:|.::...:.|:
  Rat   300 VQPHILQLKNETTSEN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355 2/7 (29%)
IG_like 80..175 CDD:214653 24/91 (26%)
Ig strand A' 83..85 CDD:409355
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 1/6 (17%)
FR2 105..114 CDD:409355 4/8 (50%)
Ig strand C 105..110 CDD:409355 3/4 (75%)
CDR2 115..129 CDD:409355 2/13 (15%)
Ig strand D 129..135 CDD:409355 1/5 (20%)
FR3 130..159 CDD:409355 8/28 (29%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 3/6 (50%)
IG_like 184..271 CDD:214653 21/97 (22%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 0/2 (0%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
Ig 117..193 CDD:472250 21/75 (28%)
Ig strand B 132..136 CDD:409353 1/3 (33%)
Ig strand C 145..152 CDD:409353 3/6 (50%)
Ig strand E 169..173 CDD:409353 1/8 (13%)
Ig strand F 183..187 CDD:409353 1/3 (33%)
Ig strand G 191..194 CDD:409353 0/2 (0%)
IgI_1_MuSK 209..298 CDD:409562 21/98 (21%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 0/4 (0%)
Ig strand B 228..235 CDD:409562 3/6 (50%)
Ig strand C 241..246 CDD:409562 2/6 (33%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 2/7 (29%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 0/7 (0%)
Ig 300..397 CDD:472250 4/16 (25%)
Ig strand B 318..322 CDD:409353
Ig strand C 331..335 CDD:409353
Ig strand E 363..367 CDD:409353
Ig strand F 377..382 CDD:409353
Ig strand G 390..393 CDD:409353
Ig_3 401..479 CDD:464046
FN3 496..588 CDD:238020
fn3 594..678 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.