DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and NEGR1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:240 Identity:59/240 - (24%)
Similarity:92/240 - (38%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKW 146
            |:....|.:|.|.|.:.:.|:|. :|:....  |:..|...::.|.|...: ..:..|::|||:.
Human    47 NMMVRKGDTAVLRCYLEDGASKG-AWLNRSS--IIFAGGDKWSVDPRVSIS-TLNKRDYSLQIQN 107

  Fly   147 AQKRDAGMYECQISTQPV-RSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYI 210
            ....|.|.|.|.:.||.. |:..|.|.|.||........|:.|::|:.:.|||.....|||.  |
Human   108 VDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPS--I 170

  Fly   211 FWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLAD--------SGKYSCAPSN----AD 263
            .|.|                      ::.|....:|....|        :|:|.|:..|    .|
Human   171 SWRH----------------------ISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPD 213

  Fly   264 VASVRVHVLNVRAIISGEHPEAMQTGSSG---CQ--------YNW 297
            |..|:| |:|....|.......:..|.||   |:        :.|
Human   214 VRKVKV-VVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 25/92 (27%)
IG_like 80..175 CDD:214653 26/93 (28%)
IG_like 184..271 CDD:214653 23/98 (23%)
IGc2 191..262 CDD:197706 17/82 (21%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 25/91 (27%)
IGc2 152..210 CDD:197706 17/81 (21%)
Ig_3 225..301 CDD:372822 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.