DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Lrit1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 / 246214 RGDID:628607 Length:623 Species:Rattus norvegicus


Alignment Length:426 Identity:82/426 - (19%)
Similarity:128/426 - (30%) Gaps:126/426 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRV 97
            |.|..:.|:: ||.........:.||......:.|.| ..||......|.|..|........||:
  Rat   147 PPEAVHFLEN-LTFLDLSNNQLMRLPEELLDTWAHLK-TGPYLSSRRTRLVLGLQDNPWVCDCRL 209

  Fly    98 RNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKR--------DAGM 154
            .:|            :|:|                     :.|...:.:.:.|        .||:
  Rat   210 YDL------------VHLL---------------------DGWASNLIFIEARLRCGSPRSLAGV 241

  Fly   155 YECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYH----- 214
            ...|:..:..:|..:|     |..|.:..|     .|||:.|.|.....|.|.  :.|..     
  Rat   242 AFSQLELRKCQSPELR-----PGVTSIISP-----LGSTVLLRCGATGIPGPE--MSWRRANGRP 294

  Fly   215 -----HEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN-ADVASVRVHVLN 273
                 |:||    ||.|.          :.:.|.:....|.|||.|.|...| ...:...:.::.
  Rat   295 LNGTVHQEV----SSDGS----------SWTLLDLPVVSLFDSGDYICQAKNFLGASETLISLIV 345

  Fly   274 VRAIISGEH---PEAMQT----GSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSLPLPS 331
            .....|.|:   |.|:..    |:....||...:...:..|....:.....:|| |:...|||.:
  Rat   346 TEPQTSTEYTGIPGALWARTGEGAEAAAYNNKLVARHVPHVPEPVALATKPSVP-SIKEELPLQN 409

  Fly   332 -QLPLP------------AAAAATTTATGESASSESVTAARASAATTT----------------- 366
             |:.:|            .....:....|::..|.|:......|..||                 
  Rat   410 FQMDVPGEFSREPSEHQETQMVRSLKVVGDTYHSVSLVWKAPQAGNTTAFSVLYAVFGQRDMRRM 474

  Fly   367 ------TTTATRKRCPAVK--SCRQTAGRVLTKRSC 394
                  |:.......|..|  :|....|.|.||..|
  Rat   475 TVEAGKTSVTIEGLAPKTKYVACVCVRGLVPTKEQC 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 15/102 (15%)
IG_like 80..175 CDD:214653 15/102 (15%)
IG_like 184..271 CDD:214653 23/97 (24%)
IGc2 191..262 CDD:197706 22/81 (27%)
Lrit1NP_647547.2 LRRNT 23..61 CDD:214470
LRR 1 60..81
LRR_8 63..143 CDD:290566
leucine-rich repeat 64..84 CDD:275378
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..128
LRR_8 131..>176 CDD:290566 7/29 (24%)
LRR_4 131..172 CDD:289563 6/25 (24%)
LRR 4 132..153 2/5 (40%)
leucine-rich repeat 133..156 CDD:275378 3/8 (38%)
LRR 5 156..177 4/21 (19%)
leucine-rich repeat 157..180 CDD:275378 4/22 (18%)
leucine-rich repeat 181..205 CDD:275378 6/24 (25%)
TPKR_C2 201..>240 CDD:301599 7/71 (10%)
Ig 257..345 CDD:299845 26/113 (23%)
IG_like 267..345 CDD:214653 22/93 (24%)
FN3 431..501 CDD:214495 10/69 (14%)
LRR 6 525..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.