DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:198 Identity:43/198 - (21%)
Similarity:76/198 - (38%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDT 137
            |.|..:.|:.:.|..|.|..::|.........|:|::...:               ..|:.....
Mouse   141 PTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTL---------------LGASAKYQV 190

  Fly   138 EDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVD--KGSTIN----- 195
            .|.:|.:....:.|.|.|.|       |:|.::...|..|..::.||...|.  :..|:|     
Mouse   191 SDGSLTVTSVSREDRGAYTC-------RAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDA 248

  Fly   196 -LTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAP 259
             |||..:..|....|.:::..|.|...:..:..|.::.:      ..|:|......|:|||:|.|
Mouse   249 LLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILID------GTLIIFRVKPEDAGKYTCVP 307

  Fly   260 SNA 262
            ||:
Mouse   308 SNS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 16/94 (17%)
IG_like 80..175 CDD:214653 16/94 (17%)
IG_like 184..271 CDD:214653 22/87 (25%)
IGc2 191..262 CDD:197706 19/76 (25%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 20/107 (19%)
Ig 231..323 CDD:386229 21/86 (24%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.