Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240777.1 | Gene: | Igsf9b / 235086 | MGIID: | 2685354 | Length: | 1443 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 43/198 - (21%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 36/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDT 137
Fly 138 EDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVD--KGSTIN----- 195
Fly 196 -LTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAP 259
Fly 260 SNA 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 16/94 (17%) |
IG_like | 80..175 | CDD:214653 | 16/94 (17%) | ||
IG_like | 184..271 | CDD:214653 | 22/87 (25%) | ||
IGc2 | 191..262 | CDD:197706 | 19/76 (25%) | ||
Igsf9b | XP_011240777.1 | Ig | 43..117 | CDD:319273 | |
I-set | 141..227 | CDD:369462 | 20/107 (19%) | ||
Ig | 231..323 | CDD:386229 | 21/86 (24%) | ||
Ig | <355..416 | CDD:386229 | |||
Ig | 440..504 | CDD:319273 | |||
FN3 | 512..607 | CDD:238020 | |||
FN3 | 623..705 | CDD:238020 | |||
PHA03247 | <900..1248 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |