Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001264214.1 | Gene: | IGSF9B / 22997 | HGNCID: | 32326 | Length: | 1437 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 77/198 - (38%) | Gaps: | 36/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDT 137
Fly 138 EDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVD--KGSTIN----- 195
Fly 196 -LTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAP 259
Fly 260 SNA 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 17/94 (18%) |
IG_like | 80..175 | CDD:214653 | 17/94 (18%) | ||
IG_like | 184..271 | CDD:214653 | 23/87 (26%) | ||
IGc2 | 191..262 | CDD:197706 | 20/76 (26%) | ||
IGSF9B | NP_001264214.1 | IG_like | 30..115 | CDD:214653 | |
Ig | 41..115 | CDD:143165 | |||
I-set | 139..225 | CDD:254352 | 21/107 (20%) | ||
IGc2 | 153..210 | CDD:197706 | 13/78 (17%) | ||
I-set | 229..321 | CDD:254352 | 22/86 (26%) | ||
Ig | 235..321 | CDD:299845 | 21/80 (26%) | ||
IG_like | 331..414 | CDD:214653 | |||
Ig | <353..414 | CDD:299845 | |||
IG_like | 426..505 | CDD:214653 | |||
Ig | 442..505 | CDD:299845 | |||
FN3 | 510..601 | CDD:238020 | |||
FN3 | 617..699 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 758..817 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 911..1081 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |