DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Iglon5

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:312 Identity:71/312 - (22%)
Similarity:107/312 - (34%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PTPGQAALLLPTAPTA--AYTHPKWMEPYFDPSTPR-NVTALMGKSAYLSCRVRNLANKTVSWIR 109
            |.||....||..|..|  |......:....:.|:|. |.|...|.:|.|||.:.....: |:|:.
Mouse     4 PAPGARLRLLAAAALAGLAVISRGLLSQSLEFSSPADNYTVCEGDNATLSCFIDEHVTR-VAWLN 67

  Fly   110 HRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQIST--QPVRSYFVRLN 172
            ..  :||..|:..:|||.|.:...: ..|::::.|......|.|:|.|...|  ||..:. |.|.
Mouse    68 RS--NILYAGNDRWTSDPRVRLLIN-TPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQ-VYLI 128

  Fly   173 VVVPTATILGGPDLHVDKGSTINLTC--------------------------------------- 198
            |.||...:.....:.|::|..:||.|                                       
Mouse   129 VHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEY 193

  Fly   199 -------------------TVKFSPE------------------------PPAYIFWYHHEEVIN 220
                               ||.:.|.                        |||...||..:.:::
Mouse   194 ECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLS 258

  Fly   221 YDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN---ADVASVRV 269
            ..|:. |:.|.||:   |.|.||..|......|.|:|..:|   |..||:|:
Mouse   259 SGSAE-GLKVQTER---TRSMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 28/97 (29%)
IG_like 80..175 CDD:214653 29/97 (30%)
IG_like 184..271 CDD:214653 31/171 (18%)
IGc2 191..262 CDD:197706 26/155 (17%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 27/92 (29%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 4/7 (57%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 2/7 (29%)
Ig strand C 61..67 CDD:409353 2/6 (33%)
CDR2 69..79 CDD:409353 3/11 (27%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 10/35 (29%)
Ig strand D 84..91 CDD:409353 1/7 (14%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 5/64 (8%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 0/4 (0%)
Ig strand F 191..199 CDD:409353 0/7 (0%)
Ig_3 217..295 CDD:404760 19/81 (23%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.